Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5E214

Protein Details
Accession C5E214    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
63-97ADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGKBasic
NLS Segment(s)
PositionSequence
68-97RKRRLKMKKHKLRKRRKRQKAEKRKQSQGK
Subcellular Location(s) mito 21, mito_nucl 13.833, cyto_mito 11.333, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
KEGG lth:KLTH0H01364g  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLGAFTRAFSSLVKTRAPAARLSSTLHAFRGFELPLRCMEPLMLLRPLAPVERAPTAMEEMLADSVMRKRRLKMKKHKLRKRRKRQKAEKRKQSQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.29
3 0.33
4 0.34
5 0.31
6 0.31
7 0.31
8 0.31
9 0.33
10 0.31
11 0.3
12 0.3
13 0.28
14 0.23
15 0.2
16 0.19
17 0.19
18 0.15
19 0.16
20 0.16
21 0.16
22 0.16
23 0.18
24 0.17
25 0.14
26 0.14
27 0.12
28 0.12
29 0.13
30 0.12
31 0.1
32 0.1
33 0.11
34 0.11
35 0.1
36 0.09
37 0.07
38 0.08
39 0.09
40 0.1
41 0.1
42 0.1
43 0.11
44 0.1
45 0.1
46 0.07
47 0.07
48 0.06
49 0.06
50 0.05
51 0.05
52 0.1
53 0.16
54 0.21
55 0.23
56 0.28
57 0.38
58 0.48
59 0.58
60 0.65
61 0.7
62 0.76
63 0.85
64 0.91
65 0.93
66 0.95
67 0.95
68 0.95
69 0.95
70 0.96
71 0.96
72 0.97
73 0.97
74 0.97
75 0.97
76 0.97
77 0.95