Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550CD99

Protein Details
Accession A0A550CD99    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
67-88LGNSHAWSLRRRERRKKPEPEVBasic
NLS Segment(s)
PositionSequence
76-84RRRERRKKP
Subcellular Location(s) nucl 17.5, cyto_nucl 13, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MDGYFDVPSVWDVRIPSRVDLPECWRVLQGRATRPSRAFRGPARCSPLGSGKSEFSGRAARSCRTQLGNSHAWSLRRRERRKKPEPEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.26
5 0.28
6 0.29
7 0.31
8 0.34
9 0.36
10 0.35
11 0.34
12 0.3
13 0.29
14 0.28
15 0.32
16 0.31
17 0.31
18 0.38
19 0.4
20 0.43
21 0.45
22 0.47
23 0.44
24 0.42
25 0.39
26 0.37
27 0.44
28 0.44
29 0.46
30 0.47
31 0.43
32 0.4
33 0.38
34 0.39
35 0.31
36 0.3
37 0.27
38 0.21
39 0.23
40 0.23
41 0.21
42 0.16
43 0.2
44 0.18
45 0.21
46 0.24
47 0.24
48 0.27
49 0.3
50 0.32
51 0.3
52 0.33
53 0.32
54 0.36
55 0.41
56 0.38
57 0.4
58 0.39
59 0.39
60 0.41
61 0.44
62 0.47
63 0.52
64 0.62
65 0.67
66 0.76
67 0.83
68 0.9