Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550BY95

Protein Details
Accession A0A550BY95    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
27-51MEHMSPRKSPHKKKKSSDQENGKQVHydrophilic
NLS Segment(s)
PositionSequence
32-41PRKSPHKKKK
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
Amino Acid Sequences MPAVSKANRAHLGNLQMGATCAVKRVMEHMSPRKSPHKKKKSSDQENGKQVAWVAKKYRGHRCLPPNSMSWTRCSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.21
4 0.21
5 0.18
6 0.14
7 0.1
8 0.09
9 0.09
10 0.09
11 0.09
12 0.12
13 0.14
14 0.17
15 0.24
16 0.32
17 0.36
18 0.38
19 0.42
20 0.5
21 0.56
22 0.63
23 0.67
24 0.69
25 0.73
26 0.78
27 0.84
28 0.86
29 0.86
30 0.85
31 0.84
32 0.82
33 0.79
34 0.75
35 0.64
36 0.53
37 0.44
38 0.4
39 0.32
40 0.29
41 0.25
42 0.3
43 0.37
44 0.44
45 0.53
46 0.53
47 0.57
48 0.61
49 0.68
50 0.7
51 0.7
52 0.66
53 0.6
54 0.6
55 0.63
56 0.55