Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550CNB0

Protein Details
Accession A0A550CNB0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-82VVRRKGRVYVICKKNPRHKQRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MLRSLMTAARPMLAQLRFAKFSPTTPAVHRATAVLTRTPDLSRGMKVRSSVKPMCDGCNVVRRKGRVYVICKKNPRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.28
4 0.29
5 0.29
6 0.33
7 0.27
8 0.29
9 0.31
10 0.29
11 0.27
12 0.27
13 0.34
14 0.31
15 0.31
16 0.29
17 0.22
18 0.21
19 0.21
20 0.2
21 0.15
22 0.14
23 0.14
24 0.15
25 0.15
26 0.15
27 0.15
28 0.15
29 0.15
30 0.17
31 0.18
32 0.18
33 0.21
34 0.26
35 0.26
36 0.32
37 0.33
38 0.32
39 0.37
40 0.37
41 0.38
42 0.34
43 0.34
44 0.29
45 0.35
46 0.36
47 0.34
48 0.38
49 0.36
50 0.38
51 0.42
52 0.46
53 0.46
54 0.52
55 0.57
56 0.63
57 0.7
58 0.75
59 0.78
60 0.81
61 0.84
62 0.86