Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CYB1

Protein Details
Accession A0A550CYB1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
53-73QQPPRPSLRRRTRLSRSVRAAHydrophilic
NLS Segment(s)
PositionSequence
32-68GLRKRRLLRRDSRAHGPRFGLQQPPRPSLRRRTRLSR
Subcellular Location(s) extr 15, mito 7, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MQLISLLFVAFLTALAVASPPRAAQLGILPGGLRKRRLLRRDSRAHGPRFGLQQPPRPSLRRRTRLSRSVRAAAAPSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.05
8 0.06
9 0.07
10 0.07
11 0.07
12 0.09
13 0.1
14 0.1
15 0.11
16 0.1
17 0.11
18 0.16
19 0.17
20 0.17
21 0.18
22 0.26
23 0.34
24 0.4
25 0.48
26 0.52
27 0.59
28 0.66
29 0.67
30 0.69
31 0.69
32 0.66
33 0.61
34 0.54
35 0.47
36 0.43
37 0.41
38 0.4
39 0.37
40 0.43
41 0.45
42 0.48
43 0.49
44 0.5
45 0.53
46 0.55
47 0.62
48 0.63
49 0.65
50 0.7
51 0.75
52 0.79
53 0.83
54 0.82
55 0.78
56 0.75
57 0.69
58 0.61