Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CZA8

Protein Details
Accession A0A550CZA8   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-49LDVRRAPPTRPPKSRKASTSRRWHCRCRRSHSGQHTLFHydrophilic
NLS Segment(s)
PositionSequence
16-28RAPPTRPPKSRKA
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MDRAGMNLRPALDVRRAPPTRPPKSRKASTSRRWHCRCRRSHSGQHTLFSFRRHLSLYGSTFAGSDAHPRRYDRNGPNQFGKTAFSRSPFSSCTEHNSCPNIRRPAYDVQDRARRLVACCKTVDAMLSFRGNSIRSVHWDGSVYSEFARACTARFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.36
3 0.38
4 0.38
5 0.47
6 0.54
7 0.57
8 0.64
9 0.68
10 0.68
11 0.76
12 0.82
13 0.81
14 0.81
15 0.81
16 0.81
17 0.85
18 0.85
19 0.86
20 0.85
21 0.87
22 0.87
23 0.86
24 0.86
25 0.83
26 0.84
27 0.82
28 0.85
29 0.83
30 0.83
31 0.76
32 0.69
33 0.62
34 0.57
35 0.5
36 0.42
37 0.36
38 0.26
39 0.26
40 0.25
41 0.24
42 0.22
43 0.25
44 0.24
45 0.22
46 0.22
47 0.19
48 0.18
49 0.17
50 0.14
51 0.09
52 0.15
53 0.17
54 0.2
55 0.22
56 0.23
57 0.26
58 0.31
59 0.4
60 0.38
61 0.46
62 0.5
63 0.51
64 0.54
65 0.52
66 0.47
67 0.39
68 0.34
69 0.25
70 0.22
71 0.2
72 0.18
73 0.2
74 0.2
75 0.22
76 0.22
77 0.24
78 0.22
79 0.22
80 0.27
81 0.29
82 0.29
83 0.3
84 0.33
85 0.32
86 0.35
87 0.42
88 0.42
89 0.38
90 0.38
91 0.39
92 0.43
93 0.46
94 0.48
95 0.44
96 0.43
97 0.5
98 0.49
99 0.47
100 0.42
101 0.38
102 0.34
103 0.4
104 0.38
105 0.33
106 0.33
107 0.33
108 0.3
109 0.29
110 0.28
111 0.2
112 0.17
113 0.17
114 0.18
115 0.16
116 0.16
117 0.18
118 0.17
119 0.17
120 0.19
121 0.18
122 0.23
123 0.3
124 0.3
125 0.29
126 0.3
127 0.28
128 0.31
129 0.29
130 0.24
131 0.18
132 0.21
133 0.19
134 0.18
135 0.22
136 0.16