Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550C583

Protein Details
Accession A0A550C583    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-28GLDEKQIKMARRRKREQEREREIEQSBasic
NLS Segment(s)
PositionSequence
12-17ARRRKR
Subcellular Location(s) nucl 12.5, mito_nucl 10.5, mito 7.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039905  CD2BP2/Lin1  
IPR003169  GYF  
IPR035445  GYF-like_dom_sf  
Gene Ontology GO:0005682  C:U5 snRNP  
Pfam View protein in Pfam  
PF02213  GYF  
PROSITE View protein in PROSITE  
PS50829  GYF  
Amino Acid Sequences MEGLDEKQIKMARRRKREQEREREIEQSGGKPSLELQLVPYLKKGESVLEALQRLGAAAKKKGHKSGNSMQVDKPPAAPSAVEIITHLASNIMSFGDVDVYSRTYEELVRSVRSSGLVEPNWDPPSADVKYEYKWDMPGTGAPEQTFGPFSEEEMKSWYKAQYFGQYGEKVKVRPAGGEWSDWDDVIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.84
4 0.89
5 0.9
6 0.92
7 0.92
8 0.88
9 0.81
10 0.74
11 0.64
12 0.58
13 0.49
14 0.41
15 0.34
16 0.29
17 0.26
18 0.22
19 0.22
20 0.21
21 0.19
22 0.16
23 0.15
24 0.21
25 0.22
26 0.23
27 0.23
28 0.21
29 0.2
30 0.21
31 0.2
32 0.14
33 0.15
34 0.17
35 0.18
36 0.19
37 0.2
38 0.18
39 0.18
40 0.15
41 0.13
42 0.12
43 0.12
44 0.12
45 0.16
46 0.22
47 0.28
48 0.32
49 0.39
50 0.44
51 0.45
52 0.5
53 0.54
54 0.58
55 0.56
56 0.55
57 0.49
58 0.48
59 0.46
60 0.39
61 0.32
62 0.23
63 0.19
64 0.17
65 0.15
66 0.11
67 0.13
68 0.12
69 0.11
70 0.09
71 0.1
72 0.1
73 0.1
74 0.09
75 0.05
76 0.05
77 0.05
78 0.05
79 0.03
80 0.03
81 0.03
82 0.03
83 0.04
84 0.04
85 0.04
86 0.05
87 0.06
88 0.06
89 0.06
90 0.06
91 0.06
92 0.07
93 0.07
94 0.11
95 0.11
96 0.12
97 0.13
98 0.13
99 0.13
100 0.13
101 0.14
102 0.12
103 0.16
104 0.16
105 0.17
106 0.18
107 0.23
108 0.23
109 0.22
110 0.2
111 0.15
112 0.21
113 0.19
114 0.19
115 0.17
116 0.18
117 0.19
118 0.23
119 0.23
120 0.18
121 0.19
122 0.19
123 0.17
124 0.16
125 0.17
126 0.18
127 0.19
128 0.19
129 0.18
130 0.18
131 0.18
132 0.18
133 0.16
134 0.13
135 0.13
136 0.12
137 0.14
138 0.21
139 0.21
140 0.21
141 0.24
142 0.25
143 0.23
144 0.26
145 0.27
146 0.21
147 0.23
148 0.26
149 0.3
150 0.32
151 0.34
152 0.38
153 0.39
154 0.4
155 0.43
156 0.44
157 0.36
158 0.37
159 0.4
160 0.34
161 0.32
162 0.32
163 0.35
164 0.33
165 0.34
166 0.33
167 0.33
168 0.32