Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550BS48

Protein Details
Accession A0A550BS48    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
146-178VPAVQRRRSPSPPRMPRMSTGRQAPKRQPPQGKHydrophilic
NLS Segment(s)
PositionSequence
150-178QRRRSPSPPRMPRMSTGRQAPKRQPPQGK
Subcellular Location(s) cyto 10.5, cyto_nucl 10, nucl 8.5, mito 4, cysk 3
Family & Domain DBs
Amino Acid Sequences MSDDEYVVVSSDEGSQNFVLVEVGPPAAPAVAPLPEDAADESESDVSGSVKSDVSGSVKSDVSESSDSDDDLLAGPPQVYRARRSAGRPSSDPKPVAEGAEGSGPKTHSSSLSLAHAMRMEGPDGACSPRPLAPLPQRGIRKPTFVPAVQRRRSPSPPRMPRMSTGRQAPKRQPPQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.14
4 0.14
5 0.13
6 0.1
7 0.08
8 0.09
9 0.07
10 0.08
11 0.07
12 0.07
13 0.07
14 0.06
15 0.06
16 0.06
17 0.06
18 0.07
19 0.08
20 0.08
21 0.09
22 0.09
23 0.1
24 0.1
25 0.1
26 0.09
27 0.09
28 0.1
29 0.09
30 0.08
31 0.08
32 0.08
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.07
40 0.08
41 0.1
42 0.11
43 0.12
44 0.13
45 0.13
46 0.13
47 0.14
48 0.13
49 0.14
50 0.14
51 0.13
52 0.13
53 0.13
54 0.13
55 0.13
56 0.12
57 0.09
58 0.08
59 0.08
60 0.05
61 0.05
62 0.05
63 0.05
64 0.07
65 0.11
66 0.12
67 0.14
68 0.17
69 0.2
70 0.23
71 0.27
72 0.34
73 0.36
74 0.39
75 0.39
76 0.4
77 0.41
78 0.43
79 0.39
80 0.3
81 0.28
82 0.25
83 0.23
84 0.19
85 0.15
86 0.11
87 0.14
88 0.14
89 0.1
90 0.11
91 0.11
92 0.11
93 0.12
94 0.12
95 0.09
96 0.12
97 0.13
98 0.13
99 0.14
100 0.15
101 0.15
102 0.15
103 0.15
104 0.12
105 0.12
106 0.11
107 0.09
108 0.08
109 0.08
110 0.09
111 0.09
112 0.11
113 0.11
114 0.12
115 0.13
116 0.14
117 0.16
118 0.17
119 0.25
120 0.31
121 0.38
122 0.4
123 0.46
124 0.49
125 0.51
126 0.57
127 0.51
128 0.48
129 0.41
130 0.45
131 0.43
132 0.41
133 0.47
134 0.5
135 0.58
136 0.58
137 0.62
138 0.62
139 0.63
140 0.71
141 0.7
142 0.71
143 0.71
144 0.76
145 0.79
146 0.8
147 0.76
148 0.74
149 0.73
150 0.7
151 0.66
152 0.66
153 0.69
154 0.7
155 0.75
156 0.78
157 0.8
158 0.82