Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DE33

Protein Details
Accession C5DE33    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHTKKFKRHHSDRYKRVSENBasic
NLS Segment(s)
PositionSequence
9-38KIVKKHTKKFKRHHSDRYKRVSENWRKQKG
Subcellular Location(s) mito 15.5, mito_nucl 11.5, nucl 6.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lth:KLTH0C05918g  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHTKKFKRHHSDRYKRVSENWRKQKGIDSVVRRRFRGNIPEPTIGYGSNKKTRFMAPSGHKTFLVANVKDLEMLMMHTRTYAAEIAHNVSSKNRVTLLARAKALGVKVTNPNGRLGLQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.93
9 0.93
10 0.93
11 0.93
12 0.92
13 0.87
14 0.78
15 0.77
16 0.77
17 0.76
18 0.76
19 0.77
20 0.75
21 0.69
22 0.68
23 0.68
24 0.63
25 0.59
26 0.56
27 0.54
28 0.56
29 0.64
30 0.67
31 0.6
32 0.55
33 0.52
34 0.49
35 0.51
36 0.48
37 0.47
38 0.49
39 0.5
40 0.48
41 0.46
42 0.41
43 0.31
44 0.26
45 0.22
46 0.21
47 0.26
48 0.27
49 0.26
50 0.27
51 0.29
52 0.3
53 0.27
54 0.3
55 0.29
56 0.38
57 0.41
58 0.41
59 0.38
60 0.36
61 0.34
62 0.33
63 0.34
64 0.24
65 0.22
66 0.22
67 0.22
68 0.21
69 0.2
70 0.13
71 0.07
72 0.08
73 0.08
74 0.07
75 0.07
76 0.07
77 0.08
78 0.07
79 0.09
80 0.09
81 0.08
82 0.09
83 0.11
84 0.14
85 0.15
86 0.16
87 0.15
88 0.15
89 0.19
90 0.18
91 0.19
92 0.17
93 0.18
94 0.2
95 0.28
96 0.35
97 0.36
98 0.36
99 0.34
100 0.34
101 0.34
102 0.32
103 0.29
104 0.22
105 0.2
106 0.27
107 0.34
108 0.38
109 0.37
110 0.39
111 0.36