Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550C2S7

Protein Details
Accession A0A550C2S7    Localization Confidence Low Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
38-67YPKQTDPARSRPRQRICCSRPRLSHPRQTAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, extr 6, cyto 4.5, cyto_nucl 4, nucl 2.5
Family & Domain DBs
Amino Acid Sequences MHSCLKVSRVPSLVSLLPVPYSAQVVRHPADPWPTFPYPKQTDPARSRPRQRICCSRPRLSHPRQTAPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.17
4 0.15
5 0.14
6 0.13
7 0.09
8 0.11
9 0.09
10 0.11
11 0.12
12 0.16
13 0.17
14 0.18
15 0.18
16 0.18
17 0.24
18 0.23
19 0.23
20 0.25
21 0.25
22 0.25
23 0.26
24 0.33
25 0.31
26 0.32
27 0.35
28 0.33
29 0.42
30 0.47
31 0.57
32 0.58
33 0.61
34 0.68
35 0.73
36 0.79
37 0.79
38 0.81
39 0.81
40 0.79
41 0.82
42 0.81
43 0.8
44 0.77
45 0.77
46 0.8
47 0.77
48 0.8
49 0.78