Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CPF3

Protein Details
Accession A0A550CPF3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
155-175LMNIKRTQKHFHTRERRGFSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 9.833, extr 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR015720  Emp24-like  
IPR009038  GOLD_dom  
IPR036598  GOLD_dom_sf  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF01105  EMP24_GP25L  
PROSITE View protein in PROSITE  
PS50866  GOLD  
Amino Acid Sequences MARSTSTLPSLLGLFSALLLLLPAVSATAFTTTIGANEKLCFYADVDKPKEKIGFYFAVQAGGAFDINYAVTNPAGKVLLGGEGERQGDYVLTANIVGEYSFCFENDMSTLTEKLIDFDIMVESEPRKEAPAKPGQISEHSSALEESIFRLNGMLMNIKRTQKHFHTRERRGFSLVQSTQNKLFWYAVLESMGIIGMAVFQVYVLQTFFTKTGRKYNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.05
5 0.04
6 0.04
7 0.04
8 0.03
9 0.03
10 0.03
11 0.03
12 0.03
13 0.03
14 0.04
15 0.06
16 0.06
17 0.06
18 0.08
19 0.08
20 0.09
21 0.12
22 0.13
23 0.12
24 0.13
25 0.14
26 0.14
27 0.14
28 0.14
29 0.12
30 0.19
31 0.22
32 0.3
33 0.34
34 0.38
35 0.38
36 0.41
37 0.42
38 0.34
39 0.32
40 0.29
41 0.26
42 0.23
43 0.29
44 0.25
45 0.23
46 0.22
47 0.2
48 0.16
49 0.13
50 0.12
51 0.05
52 0.05
53 0.04
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.07
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.08
71 0.09
72 0.08
73 0.08
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.03
86 0.03
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.07
93 0.07
94 0.08
95 0.07
96 0.08
97 0.08
98 0.07
99 0.09
100 0.08
101 0.09
102 0.08
103 0.07
104 0.06
105 0.06
106 0.07
107 0.05
108 0.06
109 0.06
110 0.06
111 0.06
112 0.07
113 0.07
114 0.08
115 0.11
116 0.13
117 0.2
118 0.28
119 0.3
120 0.31
121 0.34
122 0.34
123 0.35
124 0.36
125 0.31
126 0.24
127 0.21
128 0.2
129 0.17
130 0.16
131 0.13
132 0.09
133 0.08
134 0.09
135 0.09
136 0.08
137 0.08
138 0.08
139 0.09
140 0.1
141 0.15
142 0.13
143 0.17
144 0.22
145 0.25
146 0.28
147 0.3
148 0.36
149 0.39
150 0.5
151 0.53
152 0.6
153 0.68
154 0.75
155 0.81
156 0.81
157 0.75
158 0.69
159 0.63
160 0.55
161 0.54
162 0.47
163 0.47
164 0.43
165 0.44
166 0.42
167 0.42
168 0.4
169 0.32
170 0.29
171 0.21
172 0.21
173 0.19
174 0.18
175 0.16
176 0.15
177 0.13
178 0.12
179 0.12
180 0.07
181 0.05
182 0.04
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.04
189 0.04
190 0.05
191 0.05
192 0.06
193 0.07
194 0.09
195 0.11
196 0.15
197 0.2
198 0.23