FuNGI

C5E353

Protein Details

Accession

C5E353

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
56-76	IVYDKQQQKKIVKKWCKTVEP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

cyto_nucl 8.833, cyto 8.5, nucl 8, mito_nucl 7.833, mito 6.5

Family & Domain DBs

InterPro	View protein in InterPro IPR021056 Mt_import_IM_translocase_Tim54
Gene Ontology	GO:0005743 C:mitochondrial inner membrane
KEGG	lth:KLTH0H10472g -
Pfam	View protein in Pfam PF11711 Tim54

Amino Acid Sequences

MSSSENPKPPQDGPKILKKPGYSNPAFKAMGIPTLRLPSRNWMIFWTVLTVSVSGIVYDKQQQKKIVKKWCKTVEPLSEEKFPVNEVPRKVTVFVAPPPSDYLDTSMSVWRRFVKPVLYSSGIDYEVFTEEKQGPIRAEVAERIRELRRELIKHEEDIKRLNDEKKIWNRCKRALTGKLQHMRSSEGLDQEIEKAAAEKFKAEFDYKNLLGVYYKNKNKSNKVVAEDALVSSPEMAGGVICIGRGAYKEYIEGVHEGILGPLEPTATTNAQTEAASEKAPALPEVLSGATQTEAKVENSNEVSENATPNTETALTNESAEAESAKDSDLDPEGSAKPKPVPKPYISPKGYESAELPQELSSPNVARDLITGIPALFYQPILVIPMPNLVGFLNIPERIYRYYRRRYLAEEYCKAAASCVLQKVRPFDGTTDLEIAKSEENDWPKKWVQQGLEKDSPWVQELQGDRRVLEKLTVYDPSLIKEE

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.66
2	0.69
3	0.7
4	0.7
5	0.64
6	0.63
7	0.62
8	0.66
9	0.61
10	0.61
11	0.59
12	0.61
13	0.58
14	0.5
15	0.46
16	0.37
17	0.39
18	0.33
19	0.3
20	0.25
21	0.32
22	0.33
23	0.3
24	0.31
25	0.32
26	0.4
27	0.41
28	0.38
29	0.34
30	0.37
31	0.36
32	0.35
33	0.29
34	0.21
35	0.2
36	0.2
37	0.17
38	0.13
39	0.13
40	0.13
41	0.09
42	0.1
43	0.09
44	0.11
45	0.19
46	0.27
47	0.32
48	0.38
49	0.46
50	0.54
51	0.63
52	0.7
53	0.73
54	0.75
55	0.75
56	0.81
57	0.82
58	0.8
59	0.76
60	0.76
61	0.75
62	0.7
63	0.69
64	0.63
65	0.58
66	0.52
67	0.47
68	0.38
69	0.3
70	0.3
71	0.31
72	0.33
73	0.32
74	0.36
75	0.39
76	0.4
77	0.39
78	0.35
79	0.31
80	0.29
81	0.31
82	0.33
83	0.3
84	0.3
85	0.31
86	0.31
87	0.29
88	0.25
89	0.24
90	0.18
91	0.19
92	0.19
93	0.22
94	0.22
95	0.22
96	0.23
97	0.25
98	0.25
99	0.27
100	0.29
101	0.3
102	0.31
103	0.34
104	0.37
105	0.36
106	0.34
107	0.33
108	0.33
109	0.27
110	0.23
111	0.19
112	0.15
113	0.13
114	0.13
115	0.11
116	0.12
117	0.12
118	0.15
119	0.17
120	0.18
121	0.17
122	0.17
123	0.19
124	0.16
125	0.17
126	0.19
127	0.21
128	0.22
129	0.22
130	0.24
131	0.25
132	0.26
133	0.27
134	0.3
135	0.32
136	0.32
137	0.35
138	0.4
139	0.4
140	0.41
141	0.47
142	0.43
143	0.38
144	0.41
145	0.39
146	0.34
147	0.37
148	0.38
149	0.35
150	0.36
151	0.43
152	0.49
153	0.58
154	0.62
155	0.66
156	0.69
157	0.71
158	0.73
159	0.7
160	0.69
161	0.67
162	0.67
163	0.66
164	0.69
165	0.69
166	0.64
167	0.61
168	0.52
169	0.47
170	0.39
171	0.34
172	0.27
173	0.21
174	0.2
175	0.18
176	0.17
177	0.15
178	0.14
179	0.1
180	0.08
181	0.07
182	0.07
183	0.09
184	0.09
185	0.09
186	0.09
187	0.11
188	0.13
189	0.14
190	0.14
191	0.17
192	0.23
193	0.21
194	0.22
195	0.21
196	0.18
197	0.17
198	0.19
199	0.21
200	0.23
201	0.28
202	0.32
203	0.38
204	0.44
205	0.49
206	0.55
207	0.57
208	0.54
209	0.53
210	0.5
211	0.44
212	0.4
213	0.34
214	0.26
215	0.18
216	0.12
217	0.09
218	0.06
219	0.05
220	0.04
221	0.03
222	0.03
223	0.02
224	0.02
225	0.03
226	0.03
227	0.03
228	0.03
229	0.03
230	0.03
231	0.04
232	0.06
233	0.07
234	0.07
235	0.08
236	0.08
237	0.09
238	0.09
239	0.09
240	0.07
241	0.06
242	0.06
243	0.06
244	0.06
245	0.05
246	0.04
247	0.04
248	0.03
249	0.03
250	0.03
251	0.04
252	0.06
253	0.07
254	0.08
255	0.08
256	0.09
257	0.1
258	0.1
259	0.1
260	0.1
261	0.1
262	0.09
263	0.09
264	0.09
265	0.09
266	0.09
267	0.09
268	0.08
269	0.07
270	0.07
271	0.08
272	0.07
273	0.06
274	0.06
275	0.06
276	0.06
277	0.06
278	0.06
279	0.07
280	0.08
281	0.09
282	0.12
283	0.12
284	0.14
285	0.15
286	0.16
287	0.15
288	0.14
289	0.15
290	0.13
291	0.14
292	0.11
293	0.11
294	0.1
295	0.09
296	0.1
297	0.09
298	0.09
299	0.09
300	0.12
301	0.12
302	0.12
303	0.12
304	0.11
305	0.1
306	0.1
307	0.09
308	0.06
309	0.06
310	0.06
311	0.06
312	0.06
313	0.06
314	0.08
315	0.09
316	0.09
317	0.09
318	0.12
319	0.13
320	0.15
321	0.15
322	0.16
323	0.2
324	0.25
325	0.31
326	0.37
327	0.42
328	0.44
329	0.54
330	0.6
331	0.66
332	0.61
333	0.57
334	0.51
335	0.5
336	0.47
337	0.38
338	0.31
339	0.25
340	0.26
341	0.23
342	0.22
343	0.16
344	0.17
345	0.16
346	0.15
347	0.13
348	0.11
349	0.12
350	0.13
351	0.13
352	0.12
353	0.12
354	0.14
355	0.11
356	0.11
357	0.11
358	0.09
359	0.09
360	0.09
361	0.09
362	0.07
363	0.07
364	0.06
365	0.06
366	0.06
367	0.08
368	0.09
369	0.08
370	0.08
371	0.1
372	0.11
373	0.1
374	0.11
375	0.08
376	0.09
377	0.08
378	0.1
379	0.12
380	0.12
381	0.13
382	0.13
383	0.16
384	0.19
385	0.24
386	0.32
387	0.38
388	0.47
389	0.55
390	0.59
391	0.6
392	0.62
393	0.66
394	0.67
395	0.67
396	0.61
397	0.57
398	0.53
399	0.5
400	0.44
401	0.35
402	0.27
403	0.21
404	0.23
405	0.26
406	0.29
407	0.3
408	0.34
409	0.38
410	0.4
411	0.39
412	0.35
413	0.3
414	0.34
415	0.34
416	0.33
417	0.32
418	0.29
419	0.25
420	0.24
421	0.24
422	0.19
423	0.17
424	0.16
425	0.18
426	0.25
427	0.31
428	0.32
429	0.36
430	0.38
431	0.42
432	0.47
433	0.48
434	0.47
435	0.52
436	0.6
437	0.62
438	0.65
439	0.6
440	0.57
441	0.53
442	0.48
443	0.4
444	0.33
445	0.24
446	0.23
447	0.28
448	0.31
449	0.35
450	0.34
451	0.33
452	0.34
453	0.35
454	0.31
455	0.29
456	0.26
457	0.23
458	0.26
459	0.29
460	0.28
461	0.32
462	0.32

C5E353

3D AlphaFold-predicted Structure Viewer