Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CKM8

Protein Details
Accession A0A550CKM8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
49-69EYSPRRPTCPHRQRSSDRISDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, plas 7, mito 5, cyto 1, pero 1, E.R. 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MYLRFSILVAWPIDSVLLCLFLSVLSCLSRLSRLVSFRHPSLVRPRPAEYSPRRPTCPHRQRSSDRISDWVLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.07
4 0.08
5 0.07
6 0.06
7 0.06
8 0.06
9 0.07
10 0.06
11 0.07
12 0.05
13 0.06
14 0.06
15 0.07
16 0.08
17 0.08
18 0.11
19 0.13
20 0.15
21 0.18
22 0.23
23 0.26
24 0.25
25 0.3
26 0.28
27 0.28
28 0.35
29 0.41
30 0.39
31 0.4
32 0.42
33 0.41
34 0.43
35 0.49
36 0.47
37 0.5
38 0.56
39 0.58
40 0.59
41 0.6
42 0.66
43 0.68
44 0.71
45 0.7
46 0.69
47 0.73
48 0.77
49 0.82
50 0.82
51 0.78
52 0.7
53 0.65