Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550C1W8

Protein Details
Accession A0A550C1W8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
62-81EQEVGRRRQASCKRQRGRRABasic
NLS Segment(s)
PositionSequence
77-80RGRR
Subcellular Location(s) mito 15, cyto_nucl 6, nucl 5, cyto 5
Family & Domain DBs
Amino Acid Sequences MGLTVPSGRKRREGKDLMFLMLVPRAADADMVACASPRTSSCCKICRRYGIRDDEQNVDGGEQEVGRRRQASCKRQRGRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.63
3 0.62
4 0.54
5 0.47
6 0.41
7 0.31
8 0.24
9 0.2
10 0.1
11 0.09
12 0.07
13 0.07
14 0.07
15 0.06
16 0.05
17 0.05
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.05
24 0.05
25 0.11
26 0.14
27 0.19
28 0.23
29 0.3
30 0.36
31 0.42
32 0.46
33 0.51
34 0.53
35 0.56
36 0.6
37 0.61
38 0.61
39 0.6
40 0.58
41 0.52
42 0.47
43 0.4
44 0.32
45 0.23
46 0.18
47 0.13
48 0.11
49 0.07
50 0.09
51 0.15
52 0.17
53 0.2
54 0.22
55 0.23
56 0.33
57 0.43
58 0.52
59 0.56
60 0.66
61 0.73