Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550C8F4

Protein Details
Accession A0A550C8F4    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-103AESESKWNSKKKKRLEKYIDKKLKQEHydrophilic
NLS Segment(s)
PositionSequence
18-35GWGTRRRPDGRRPLGRGR
66-74RERKEKMKA
81-99ESKWNSKKKKRLEKYIDKK
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGHGHLRERYNAKARQSGWGTRRRPDGRRPLGRGRSANPHADGGTSAKIDSNADVIVPKTEEEKERERKEKMKAQLIAESESKWNSKKKKRLEKYIDKKLKQEERVHLFEKLAKTQTEVSNTFQLQSSATLGTRKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.55
3 0.56
4 0.57
5 0.56
6 0.6
7 0.58
8 0.56
9 0.66
10 0.64
11 0.65
12 0.66
13 0.7
14 0.71
15 0.76
16 0.78
17 0.78
18 0.79
19 0.8
20 0.74
21 0.66
22 0.66
23 0.6
24 0.57
25 0.48
26 0.42
27 0.34
28 0.3
29 0.27
30 0.2
31 0.17
32 0.13
33 0.11
34 0.1
35 0.11
36 0.1
37 0.1
38 0.09
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.09
48 0.12
49 0.15
50 0.23
51 0.32
52 0.37
53 0.42
54 0.44
55 0.47
56 0.52
57 0.55
58 0.53
59 0.52
60 0.5
61 0.47
62 0.48
63 0.44
64 0.39
65 0.33
66 0.28
67 0.21
68 0.19
69 0.19
70 0.18
71 0.23
72 0.3
73 0.39
74 0.47
75 0.57
76 0.67
77 0.74
78 0.82
79 0.86
80 0.87
81 0.88
82 0.91
83 0.9
84 0.81
85 0.78
86 0.76
87 0.75
88 0.71
89 0.69
90 0.67
91 0.64
92 0.67
93 0.64
94 0.56
95 0.48
96 0.45
97 0.41
98 0.36
99 0.33
100 0.27
101 0.28
102 0.32
103 0.35
104 0.36
105 0.35
106 0.34
107 0.38
108 0.38
109 0.36
110 0.31
111 0.27
112 0.22
113 0.21
114 0.19
115 0.14
116 0.15