Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550CAA1

Protein Details
Accession A0A550CAA1    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MTIHIKNIKVRPKKKIQRTPCIYQLNSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MTIHIKNIKVRPKKKIQRTPCIYQLNSMLGCWAAHGDVMSAGECASHAQMLFECMRTMPPSKPTHKPTINYHLSRLGNRIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.87
4 0.87
5 0.87
6 0.85
7 0.83
8 0.8
9 0.7
10 0.61
11 0.54
12 0.46
13 0.39
14 0.31
15 0.22
16 0.14
17 0.14
18 0.11
19 0.09
20 0.05
21 0.04
22 0.04
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.05
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.1
43 0.12
44 0.15
45 0.15
46 0.23
47 0.3
48 0.36
49 0.44
50 0.5
51 0.57
52 0.61
53 0.64
54 0.64
55 0.67
56 0.71
57 0.65
58 0.62
59 0.6
60 0.57
61 0.54