Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550C212

Protein Details
Accession A0A550C212   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
76-101APTCPDRRRGPWRRPRSLARARQKTRBasic
NLS Segment(s)
PositionSequence
37-53PVRTRRVPRASRLREGR
82-99RRRGPWRRPRSLARARQK
Subcellular Location(s) plas 7, nucl 6, mito 6, mito_nucl 6
Family & Domain DBs
Amino Acid Sequences MTTASPKHRPLPPADQLTTNDAQPSRGLPRPLPHPSPVRTRRVPRASRLREGRGRCMGRGNRDAPPCAPCAPTRDAPTCPDRRRGPWRRPRSLARARQKTRTAVGHADFGRGCRQPAPPPPGPYSPRTSCYSSKTLGSPPWRLLVALLRYCEGARQQRHLRVSFSSSSSPHGTLPPLLDIRTLIGRSCGGALCLGVSPIIAPFLLVWEIVLARDMAVGLWNWRADRAYCPCHTPVRTPDGPHNPPDVSTTPLRCPRQLSPRVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.57
3 0.54
4 0.56
5 0.5
6 0.4
7 0.36
8 0.28
9 0.27
10 0.24
11 0.25
12 0.24
13 0.28
14 0.31
15 0.3
16 0.35
17 0.43
18 0.5
19 0.5
20 0.5
21 0.53
22 0.54
23 0.61
24 0.64
25 0.64
26 0.65
27 0.69
28 0.73
29 0.76
30 0.77
31 0.76
32 0.8
33 0.78
34 0.79
35 0.78
36 0.77
37 0.74
38 0.73
39 0.71
40 0.69
41 0.65
42 0.56
43 0.58
44 0.55
45 0.55
46 0.57
47 0.53
48 0.5
49 0.51
50 0.52
51 0.44
52 0.42
53 0.37
54 0.31
55 0.29
56 0.24
57 0.26
58 0.29
59 0.31
60 0.33
61 0.34
62 0.34
63 0.36
64 0.43
65 0.47
66 0.46
67 0.49
68 0.48
69 0.52
70 0.62
71 0.67
72 0.7
73 0.71
74 0.78
75 0.79
76 0.81
77 0.81
78 0.8
79 0.81
80 0.8
81 0.8
82 0.8
83 0.76
84 0.77
85 0.74
86 0.67
87 0.62
88 0.55
89 0.48
90 0.43
91 0.4
92 0.38
93 0.33
94 0.32
95 0.27
96 0.24
97 0.25
98 0.2
99 0.2
100 0.16
101 0.19
102 0.22
103 0.3
104 0.36
105 0.36
106 0.4
107 0.43
108 0.46
109 0.46
110 0.44
111 0.43
112 0.38
113 0.37
114 0.37
115 0.37
116 0.34
117 0.36
118 0.36
119 0.3
120 0.29
121 0.27
122 0.26
123 0.27
124 0.28
125 0.26
126 0.24
127 0.25
128 0.23
129 0.21
130 0.19
131 0.19
132 0.19
133 0.18
134 0.18
135 0.16
136 0.17
137 0.17
138 0.17
139 0.17
140 0.2
141 0.21
142 0.28
143 0.33
144 0.38
145 0.44
146 0.44
147 0.42
148 0.36
149 0.39
150 0.33
151 0.31
152 0.27
153 0.23
154 0.25
155 0.25
156 0.24
157 0.2
158 0.19
159 0.18
160 0.16
161 0.16
162 0.16
163 0.15
164 0.14
165 0.13
166 0.12
167 0.13
168 0.14
169 0.14
170 0.1
171 0.11
172 0.11
173 0.11
174 0.12
175 0.1
176 0.08
177 0.08
178 0.08
179 0.07
180 0.07
181 0.07
182 0.05
183 0.05
184 0.05
185 0.04
186 0.05
187 0.04
188 0.04
189 0.04
190 0.05
191 0.06
192 0.05
193 0.05
194 0.05
195 0.06
196 0.06
197 0.06
198 0.05
199 0.05
200 0.05
201 0.05
202 0.04
203 0.05
204 0.06
205 0.07
206 0.1
207 0.11
208 0.11
209 0.13
210 0.15
211 0.15
212 0.22
213 0.28
214 0.32
215 0.33
216 0.37
217 0.4
218 0.46
219 0.48
220 0.48
221 0.47
222 0.49
223 0.51
224 0.51
225 0.57
226 0.59
227 0.6
228 0.57
229 0.56
230 0.47
231 0.44
232 0.46
233 0.38
234 0.32
235 0.34
236 0.35
237 0.38
238 0.47
239 0.5
240 0.48
241 0.52
242 0.56
243 0.6