FuNGI

A0A550C5R0

Protein Details

Accession

A0A550C5R0

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
80-113	FEKARSTRRRASSTRRRMRRTTPRRAACRDRAGA	Hydrophilic

NLS Segment(s)

Position	Sequence
84-104	RSTRRRASSTRRRMRRTTPRR

Subcellular Location(s)

extr 19, mito 6

Family & Domain DBs

InterPro	View protein in InterPro IPR001623 DnaJ_domain IPR036869 J_dom_sf IPR011990 TPR-like_helical_dom_sf
Pfam	View protein in Pfam PF00226 DnaJ
PROSITE	View protein in PROSITE PS50076 DNAJ_2
CDD	cd06257 DnaJ

Amino Acid Sequences

MRVLALASVLLFALRAYADASAGGLYPPGLAPLINRANVLLSSGQFNDAPSSITADYLLYWKRATAYYSLNRYNSALDDFEKARSTRRRASSTRRRMRRTTPRRAACRDRAGASSGEEGRMEHKSQLWTACVEDSSAALRTASTHRDPPAARGVRAGGEDIEGAVADMTRLTHLLPPSTDLFVRIFRLSYFFLPNSGASTNPLKQCLHQDPDSKPCFKLHKLAKNLDKASGKNNDVMNRFDEALQEHAQRELLFSPRRQTLVRALCKAYMKAGQTKKAEPWCETLLGMSGCSEDLDGLEEYQEAIRVFEKAFEASGRSDRDIHQRMQKAQKLLKQSKQKDYYKILGVPRDADDRTIKKAFRTAAKTAHPDKGGSEAKMAAVNEAYETLSDPELRARFDAGDDPNDPQGGQQHPFTGFGGGGHPFAQFFQQSGGHGGFPGGGHGGGSYQFHFGH

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.05
2	0.05
3	0.06
4	0.06
5	0.07
6	0.07
7	0.08
8	0.07
9	0.07
10	0.07
11	0.06
12	0.06
13	0.06
14	0.06
15	0.07
16	0.07
17	0.06
18	0.07
19	0.16
20	0.21
21	0.21
22	0.22
23	0.21
24	0.22
25	0.22
26	0.24
27	0.17
28	0.13
29	0.15
30	0.16
31	0.17
32	0.16
33	0.17
34	0.17
35	0.15
36	0.16
37	0.13
38	0.17
39	0.15
40	0.15
41	0.15
42	0.12
43	0.13
44	0.16
45	0.17
46	0.15
47	0.15
48	0.15
49	0.17
50	0.19
51	0.2
52	0.19
53	0.26
54	0.32
55	0.4
56	0.45
57	0.44
58	0.44
59	0.43
60	0.4
61	0.33
62	0.28
63	0.22
64	0.18
65	0.21
66	0.21
67	0.22
68	0.25
69	0.23
70	0.29
71	0.36
72	0.42
73	0.47
74	0.54
75	0.6
76	0.64
77	0.74
78	0.77
79	0.8
80	0.83
81	0.84
82	0.84
83	0.82
84	0.85
85	0.85
86	0.85
87	0.85
88	0.85
89	0.85
90	0.86
91	0.88
92	0.86
93	0.84
94	0.82
95	0.75
96	0.67
97	0.59
98	0.53
99	0.45
100	0.37
101	0.33
102	0.25
103	0.21
104	0.19
105	0.17
106	0.17
107	0.19
108	0.19
109	0.15
110	0.18
111	0.2
112	0.22
113	0.24
114	0.22
115	0.2
116	0.2
117	0.19
118	0.16
119	0.14
120	0.11
121	0.1
122	0.1
123	0.1
124	0.09
125	0.08
126	0.08
127	0.1
128	0.13
129	0.17
130	0.18
131	0.21
132	0.22
133	0.28
134	0.29
135	0.3
136	0.37
137	0.35
138	0.33
139	0.31
140	0.3
141	0.26
142	0.26
143	0.23
144	0.13
145	0.1
146	0.1
147	0.08
148	0.07
149	0.05
150	0.04
151	0.04
152	0.03
153	0.03
154	0.03
155	0.03
156	0.03
157	0.04
158	0.04
159	0.07
160	0.08
161	0.1
162	0.1
163	0.12
164	0.14
165	0.15
166	0.14
167	0.13
168	0.14
169	0.14
170	0.16
171	0.14
172	0.12
173	0.11
174	0.14
175	0.14
176	0.15
177	0.17
178	0.15
179	0.15
180	0.16
181	0.16
182	0.15
183	0.14
184	0.12
185	0.11
186	0.14
187	0.18
188	0.18
189	0.21
190	0.19
191	0.2
192	0.27
193	0.3
194	0.31
195	0.31
196	0.36
197	0.36
198	0.44
199	0.47
200	0.42
201	0.37
202	0.36
203	0.37
204	0.33
205	0.38
206	0.38
207	0.43
208	0.48
209	0.54
210	0.56
211	0.58
212	0.57
213	0.54
214	0.48
215	0.41
216	0.4
217	0.38
218	0.33
219	0.31
220	0.32
221	0.32
222	0.31
223	0.31
224	0.28
225	0.23
226	0.23
227	0.18
228	0.17
229	0.13
230	0.14
231	0.15
232	0.15
233	0.13
234	0.13
235	0.14
236	0.13
237	0.13
238	0.11
239	0.15
240	0.16
241	0.17
242	0.21
243	0.22
244	0.24
245	0.24
246	0.25
247	0.28
248	0.35
249	0.39
250	0.38
251	0.37
252	0.39
253	0.4
254	0.38
255	0.31
256	0.26
257	0.23
258	0.28
259	0.31
260	0.35
261	0.36
262	0.38
263	0.42
264	0.44
265	0.45
266	0.38
267	0.39
268	0.34
269	0.31
270	0.29
271	0.23
272	0.19
273	0.17
274	0.14
275	0.1
276	0.08
277	0.07
278	0.07
279	0.07
280	0.04
281	0.04
282	0.06
283	0.06
284	0.06
285	0.06
286	0.06
287	0.06
288	0.07
289	0.08
290	0.06
291	0.07
292	0.07
293	0.08
294	0.08
295	0.1
296	0.11
297	0.09
298	0.1
299	0.1
300	0.11
301	0.12
302	0.17
303	0.18
304	0.18
305	0.2
306	0.22
307	0.31
308	0.34
309	0.37
310	0.4
311	0.43
312	0.49
313	0.57
314	0.59
315	0.57
316	0.58
317	0.58
318	0.61
319	0.63
320	0.64
321	0.65
322	0.68
323	0.71
324	0.75
325	0.76
326	0.73
327	0.71
328	0.69
329	0.64
330	0.62
331	0.56
332	0.51
333	0.46
334	0.41
335	0.37
336	0.36
337	0.31
338	0.28
339	0.31
340	0.29
341	0.34
342	0.37
343	0.36
344	0.33
345	0.38
346	0.4
347	0.41
348	0.45
349	0.44
350	0.46
351	0.51
352	0.57
353	0.56
354	0.58
355	0.51
356	0.45
357	0.41
358	0.42
359	0.39
360	0.32
361	0.3
362	0.24
363	0.24
364	0.26
365	0.25
366	0.18
367	0.14
368	0.13
369	0.12
370	0.12
371	0.11
372	0.08
373	0.09
374	0.1
375	0.1
376	0.11
377	0.11
378	0.16
379	0.18
380	0.19
381	0.19
382	0.19
383	0.18
384	0.2
385	0.26
386	0.22
387	0.25
388	0.25
389	0.27
390	0.28
391	0.27
392	0.25
393	0.2
394	0.23
395	0.23
396	0.23
397	0.22
398	0.24
399	0.25
400	0.27
401	0.26
402	0.22
403	0.17
404	0.15
405	0.17
406	0.14
407	0.14
408	0.13
409	0.13
410	0.11
411	0.12
412	0.15
413	0.13
414	0.12
415	0.15
416	0.16
417	0.17
418	0.21
419	0.22
420	0.18
421	0.18
422	0.17
423	0.15
424	0.13
425	0.13
426	0.1
427	0.09
428	0.08
429	0.08
430	0.09
431	0.09
432	0.11
433	0.11

A0A550C5R0

3D AlphaFold-predicted Structure Viewer