Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550BVD7

Protein Details
Accession A0A550BVD7   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
131-162VDDPKGKGKPKGKHRGGKKVRERWARAKERDGBasic
NLS Segment(s)
PositionSequence
135-166KGKGKPKGKHRGGKKVRERWARAKERDGNPDP
Subcellular Location(s) cyto 12.5, cyto_nucl 9.5, nucl 5.5, mito 5, extr 4
Family & Domain DBs
Amino Acid Sequences MVVEHVGGEVRWAGPSRRAAWPTTDPFAVAQAALSTPLAPVVSLIPPTPAAPPSAADPHVASLLERFSDPLDHVDTPGASSSSGGASSSLLGRVAPPPLASRLSTGPGVPSLEERLSSRAEDGDDADDMDVDDPKGKGKPKGKHRGGKKVRERWARAKERDGNPDPRYPGGFGPRGPPPSGPGAASSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.25
3 0.28
4 0.35
5 0.37
6 0.37
7 0.41
8 0.47
9 0.47
10 0.45
11 0.41
12 0.33
13 0.31
14 0.31
15 0.25
16 0.17
17 0.11
18 0.08
19 0.08
20 0.08
21 0.08
22 0.06
23 0.06
24 0.07
25 0.06
26 0.05
27 0.06
28 0.07
29 0.08
30 0.09
31 0.09
32 0.09
33 0.1
34 0.11
35 0.12
36 0.11
37 0.11
38 0.11
39 0.11
40 0.13
41 0.16
42 0.16
43 0.15
44 0.15
45 0.15
46 0.15
47 0.14
48 0.11
49 0.09
50 0.09
51 0.08
52 0.08
53 0.07
54 0.07
55 0.08
56 0.08
57 0.1
58 0.12
59 0.12
60 0.12
61 0.12
62 0.12
63 0.11
64 0.11
65 0.09
66 0.06
67 0.06
68 0.06
69 0.05
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.04
79 0.05
80 0.06
81 0.06
82 0.06
83 0.07
84 0.07
85 0.09
86 0.11
87 0.11
88 0.12
89 0.12
90 0.14
91 0.14
92 0.13
93 0.11
94 0.11
95 0.11
96 0.09
97 0.09
98 0.1
99 0.09
100 0.1
101 0.11
102 0.12
103 0.13
104 0.13
105 0.12
106 0.11
107 0.11
108 0.11
109 0.11
110 0.1
111 0.09
112 0.09
113 0.08
114 0.07
115 0.07
116 0.07
117 0.06
118 0.05
119 0.07
120 0.07
121 0.09
122 0.13
123 0.16
124 0.24
125 0.32
126 0.41
127 0.5
128 0.61
129 0.69
130 0.74
131 0.8
132 0.83
133 0.85
134 0.87
135 0.86
136 0.85
137 0.85
138 0.87
139 0.85
140 0.84
141 0.85
142 0.85
143 0.8
144 0.8
145 0.8
146 0.77
147 0.79
148 0.75
149 0.74
150 0.68
151 0.68
152 0.62
153 0.55
154 0.51
155 0.43
156 0.41
157 0.39
158 0.39
159 0.33
160 0.35
161 0.39
162 0.41
163 0.4
164 0.36
165 0.32
166 0.35
167 0.35
168 0.31