Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550CDT6

Protein Details
Accession A0A550CDT6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-82AGQRVRGRRRRRWGGRLVSRRCRRWSRRSVRCGGBasic
102-132SRSWAGRHAGRRRIQRRRRRRRRPSRCTSRCBasic
NLS Segment(s)
PositionSequence
47-76RAAGQRVRGRRRRRWGGRLVSRRCRRWSRR
94-126RAKSRGGPSRSWAGRHAGRRRIQRRRRRRRRPS
Subcellular Location(s) extr 17, mito 5, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
Amino Acid Sequences MVLASGRAGWMATWSVSATALAAVATARWAWGGCSCGWAVRRWAGDRAAGQRVRGRRRRRWGGRLVSRRCRRWSRRSVRCGGWPWSLQSCALHRAKSRGGPSRSWAGRHAGRRRIQRRRRRRRRPSRCTSRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.1
5 0.08
6 0.06
7 0.06
8 0.05
9 0.05
10 0.04
11 0.04
12 0.05
13 0.04
14 0.04
15 0.04
16 0.05
17 0.05
18 0.07
19 0.1
20 0.09
21 0.11
22 0.11
23 0.14
24 0.15
25 0.17
26 0.18
27 0.2
28 0.23
29 0.23
30 0.27
31 0.24
32 0.26
33 0.27
34 0.29
35 0.32
36 0.29
37 0.29
38 0.3
39 0.36
40 0.43
41 0.49
42 0.53
43 0.55
44 0.65
45 0.74
46 0.78
47 0.79
48 0.79
49 0.81
50 0.82
51 0.83
52 0.8
53 0.79
54 0.78
55 0.75
56 0.72
57 0.73
58 0.71
59 0.71
60 0.75
61 0.75
62 0.78
63 0.81
64 0.8
65 0.73
66 0.72
67 0.66
68 0.6
69 0.54
70 0.45
71 0.4
72 0.36
73 0.33
74 0.26
75 0.24
76 0.21
77 0.24
78 0.25
79 0.26
80 0.26
81 0.3
82 0.33
83 0.37
84 0.42
85 0.44
86 0.45
87 0.44
88 0.46
89 0.51
90 0.5
91 0.47
92 0.42
93 0.4
94 0.43
95 0.5
96 0.55
97 0.54
98 0.59
99 0.67
100 0.75
101 0.79
102 0.83
103 0.85
104 0.87
105 0.9
106 0.94
107 0.95
108 0.96
109 0.96
110 0.97
111 0.97
112 0.97