Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550BW88

Protein Details
Accession A0A550BW88    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
27-52MEHMSPRKSPHKKKRSSDQENGKQVAHydrophilic
NLS Segment(s)
PositionSequence
33-41RKSPHKKKR
Subcellular Location(s) mito 19, nucl 6
Family & Domain DBs
Amino Acid Sequences MPAVSKANRAHLGNLQMGATCAVKRVMEHMSPRKSPHKKKRSSDQENGKQVAWVAKKYRGHRCLPPNIMSWT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.21
4 0.2
5 0.18
6 0.14
7 0.1
8 0.09
9 0.09
10 0.09
11 0.09
12 0.12
13 0.14
14 0.17
15 0.24
16 0.31
17 0.35
18 0.37
19 0.42
20 0.49
21 0.55
22 0.62
23 0.66
24 0.68
25 0.72
26 0.77
27 0.84
28 0.85
29 0.85
30 0.83
31 0.83
32 0.83
33 0.8
34 0.75
35 0.64
36 0.53
37 0.45
38 0.42
39 0.34
40 0.29
41 0.26
42 0.32
43 0.39
44 0.46
45 0.55
46 0.55
47 0.59
48 0.63
49 0.68
50 0.71
51 0.71
52 0.68