Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DLB5

Protein Details
Accession C5DLB5   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
19-38QQISIPKRPLKKIRLGKARPHydrophilic
NLS Segment(s)
PositionSequence
25-37KRPLKKIRLGKAR
175-180KKRDKK
Subcellular Location(s) mito 12, nucl 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034600  MRPL36_yeast  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG lth:KLTH0F11616g  -  
Amino Acid Sequences MLRSVIFKRFATGGYHGAQQISIPKRPLKKIRLGKARPAIYHKFDVQVELSDGSVITRRSQFPKDQIRLIQDQRNNPLWNQSRDDLVVVDANAGGRLDRFKQKYDTLFNFEAPAKQPAADAKGKNKVKEVKSAPEEEAAATPAAEEEDAFGMDDYMSLLDQNAQQVQSGGKLATKKRDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.26
4 0.25
5 0.23
6 0.2
7 0.24
8 0.25
9 0.27
10 0.29
11 0.34
12 0.41
13 0.5
14 0.59
15 0.58
16 0.64
17 0.7
18 0.76
19 0.81
20 0.79
21 0.79
22 0.79
23 0.76
24 0.7
25 0.67
26 0.63
27 0.57
28 0.56
29 0.48
30 0.43
31 0.37
32 0.35
33 0.29
34 0.24
35 0.2
36 0.16
37 0.14
38 0.1
39 0.1
40 0.08
41 0.1
42 0.1
43 0.1
44 0.13
45 0.16
46 0.21
47 0.25
48 0.29
49 0.35
50 0.45
51 0.46
52 0.47
53 0.47
54 0.47
55 0.49
56 0.49
57 0.47
58 0.41
59 0.41
60 0.42
61 0.45
62 0.41
63 0.35
64 0.4
65 0.39
66 0.38
67 0.37
68 0.33
69 0.28
70 0.28
71 0.28
72 0.19
73 0.14
74 0.11
75 0.07
76 0.07
77 0.06
78 0.05
79 0.05
80 0.04
81 0.04
82 0.03
83 0.05
84 0.07
85 0.14
86 0.16
87 0.19
88 0.23
89 0.27
90 0.31
91 0.37
92 0.38
93 0.38
94 0.37
95 0.35
96 0.33
97 0.3
98 0.27
99 0.22
100 0.21
101 0.15
102 0.14
103 0.14
104 0.14
105 0.18
106 0.22
107 0.22
108 0.26
109 0.36
110 0.39
111 0.4
112 0.45
113 0.48
114 0.45
115 0.52
116 0.51
117 0.5
118 0.51
119 0.53
120 0.48
121 0.41
122 0.39
123 0.31
124 0.26
125 0.19
126 0.14
127 0.1
128 0.09
129 0.07
130 0.07
131 0.06
132 0.05
133 0.05
134 0.06
135 0.06
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.07
147 0.08
148 0.11
149 0.13
150 0.13
151 0.13
152 0.14
153 0.15
154 0.15
155 0.15
156 0.13
157 0.14
158 0.21
159 0.26
160 0.35