Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DKJ9

Protein Details
Accession C5DKJ9    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
130-171ADAEQQTPKKHKKDKKDKKDKKDKKEKKDKKDKKDKKHKHKABasic
NLS Segment(s)
PositionSequence
137-171PKKHKKDKKDKKDKKDKKEKKDKKDKKDKKHKHKA
Subcellular Location(s) nucl 13.5, cyto_nucl 13.333, cyto 11, mito_nucl 8.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR013240  DNA-dir_RNA_pol1_su_RPA34  
Gene Ontology GO:0006360  P:transcription by RNA polymerase I  
KEGG lth:KLTH0F05346g  -  
Pfam View protein in Pfam  
PF08208  RNA_polI_A34  
Amino Acid Sequences MAEANGGLETSGYKKCKDLGDFQAEGKEVWLIRAPRKLDLSKVKSLPVDFTGKGKAAFEKQGLTFEVREDSHEDGSGLSVLVPADKQTLVSGAGVSRVFTISETVDLEQQAKDRKRRAPEPEPESGSVEADAEQQTPKKHKKDKKDKKDKKDKKEKKDKKDKKDKKHKHKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.25
3 0.32
4 0.35
5 0.39
6 0.42
7 0.47
8 0.48
9 0.47
10 0.46
11 0.4
12 0.36
13 0.28
14 0.22
15 0.14
16 0.14
17 0.18
18 0.18
19 0.23
20 0.29
21 0.3
22 0.32
23 0.38
24 0.38
25 0.41
26 0.48
27 0.5
28 0.51
29 0.51
30 0.49
31 0.46
32 0.45
33 0.39
34 0.32
35 0.3
36 0.23
37 0.24
38 0.23
39 0.22
40 0.22
41 0.2
42 0.19
43 0.17
44 0.2
45 0.19
46 0.19
47 0.18
48 0.2
49 0.2
50 0.19
51 0.17
52 0.14
53 0.16
54 0.13
55 0.14
56 0.15
57 0.15
58 0.14
59 0.14
60 0.13
61 0.1
62 0.1
63 0.09
64 0.06
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.05
73 0.05
74 0.04
75 0.05
76 0.06
77 0.06
78 0.06
79 0.05
80 0.07
81 0.07
82 0.07
83 0.07
84 0.06
85 0.06
86 0.06
87 0.07
88 0.06
89 0.07
90 0.08
91 0.08
92 0.09
93 0.09
94 0.1
95 0.09
96 0.12
97 0.19
98 0.23
99 0.29
100 0.35
101 0.41
102 0.48
103 0.55
104 0.62
105 0.63
106 0.68
107 0.68
108 0.68
109 0.66
110 0.6
111 0.54
112 0.46
113 0.36
114 0.27
115 0.21
116 0.14
117 0.13
118 0.12
119 0.1
120 0.11
121 0.13
122 0.18
123 0.27
124 0.35
125 0.42
126 0.52
127 0.6
128 0.69
129 0.78
130 0.85
131 0.88
132 0.91
133 0.92
134 0.94
135 0.97
136 0.96
137 0.96
138 0.96
139 0.95
140 0.95
141 0.95
142 0.95
143 0.94
144 0.96
145 0.95
146 0.95
147 0.96
148 0.95
149 0.95
150 0.96
151 0.96