Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550BX17

Protein Details
Accession A0A550BX17    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-46RSPISPRRRRLTPYRRRAPIFHydrophilic
129-172ISQSRRGLTPRRRRRSSDSPVVVRLAPRRRRAPDSPRRRRLSLPHydrophilic
NLS Segment(s)
PositionSequence
31-87PRRRRLTPYRRRAPIFQGRRRRLSPRRSPGSQGRRSPGLPRRRSWSPVSQGRRRRLS
135-168GLTPRRRRRSSDSPVVVRLAPRRRRAPDSPRRRR
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6
Family & Domain DBs
Amino Acid Sequences MRLSPQGRLAPPTSWSPISPLTVVVRSPISPRRRRLTPYRRRAPIFQGRRRRLSPRRSPGSQGRRSPGLPRRRSWSPVSQGRRRRLSPKVVVDAWLPQGRHRLAPYRRRSSTPVSLSSAYLPSSSTTSISQSRRGLTPRRRRRSSDSPVVVRLAPRRRRAPDSPRRRRLSLPPTSVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.29
4 0.29
5 0.29
6 0.27
7 0.25
8 0.23
9 0.23
10 0.22
11 0.21
12 0.19
13 0.18
14 0.23
15 0.28
16 0.35
17 0.41
18 0.49
19 0.54
20 0.59
21 0.65
22 0.71
23 0.74
24 0.75
25 0.78
26 0.8
27 0.81
28 0.79
29 0.76
30 0.75
31 0.74
32 0.74
33 0.72
34 0.74
35 0.72
36 0.75
37 0.75
38 0.76
39 0.74
40 0.74
41 0.75
42 0.75
43 0.76
44 0.72
45 0.74
46 0.74
47 0.75
48 0.73
49 0.67
50 0.6
51 0.56
52 0.54
53 0.56
54 0.54
55 0.54
56 0.51
57 0.48
58 0.51
59 0.52
60 0.55
61 0.51
62 0.51
63 0.49
64 0.53
65 0.59
66 0.61
67 0.65
68 0.68
69 0.69
70 0.64
71 0.61
72 0.58
73 0.59
74 0.58
75 0.54
76 0.51
77 0.45
78 0.43
79 0.37
80 0.33
81 0.28
82 0.23
83 0.18
84 0.15
85 0.2
86 0.2
87 0.21
88 0.21
89 0.27
90 0.33
91 0.42
92 0.51
93 0.54
94 0.56
95 0.58
96 0.6
97 0.58
98 0.59
99 0.54
100 0.48
101 0.43
102 0.41
103 0.38
104 0.35
105 0.29
106 0.21
107 0.16
108 0.13
109 0.1
110 0.11
111 0.11
112 0.11
113 0.1
114 0.14
115 0.2
116 0.22
117 0.27
118 0.28
119 0.3
120 0.33
121 0.38
122 0.44
123 0.48
124 0.57
125 0.62
126 0.7
127 0.74
128 0.77
129 0.81
130 0.82
131 0.81
132 0.81
133 0.78
134 0.72
135 0.69
136 0.64
137 0.56
138 0.5
139 0.48
140 0.48
141 0.47
142 0.51
143 0.57
144 0.62
145 0.68
146 0.74
147 0.76
148 0.77
149 0.81
150 0.84
151 0.85
152 0.85
153 0.82
154 0.79
155 0.78
156 0.78
157 0.77