Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550CU38

Protein Details
Accession A0A550CU38    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKKPKTYHydrophilic
NLS Segment(s)
PositionSequence
14-25KKAHRNGIKKPK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPKTYSTRSMKGVDAKFRRNMRYAAAASRTARLEQKAAAAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.81
7 0.84
8 0.83
9 0.78
10 0.73
11 0.73
12 0.69
13 0.66
14 0.65
15 0.62
16 0.6
17 0.59
18 0.57
19 0.5
20 0.5
21 0.48
22 0.48
23 0.44
24 0.42
25 0.46
26 0.48
27 0.5
28 0.45
29 0.44
30 0.38
31 0.4
32 0.38
33 0.36
34 0.35
35 0.36
36 0.34
37 0.36
38 0.34
39 0.29
40 0.31
41 0.28
42 0.27
43 0.24