Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550CP64

Protein Details
Accession A0A550CP64    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
77-96QVAPCRRRARSPPLGRQAKRHydrophilic
NLS Segment(s)
PositionSequence
83-100RRARSPPLGRQAKRTPAP
Subcellular Location(s) mito 17, extr 4, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MLGVPRSSRLSQPLIVAANASSAVRPSAPFAGAQGAPLRRCPRSPPFAVALCRLPSPLRCVAPFAVKSSASPSPSRQVAPCRRRARSPPLGRQAKRTPAPLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.24
4 0.19
5 0.15
6 0.13
7 0.12
8 0.07
9 0.06
10 0.07
11 0.07
12 0.08
13 0.09
14 0.11
15 0.11
16 0.11
17 0.11
18 0.14
19 0.13
20 0.14
21 0.16
22 0.17
23 0.17
24 0.22
25 0.25
26 0.23
27 0.24
28 0.3
29 0.33
30 0.37
31 0.38
32 0.37
33 0.37
34 0.39
35 0.4
36 0.36
37 0.31
38 0.25
39 0.23
40 0.2
41 0.17
42 0.14
43 0.17
44 0.19
45 0.19
46 0.18
47 0.2
48 0.21
49 0.26
50 0.26
51 0.24
52 0.22
53 0.21
54 0.21
55 0.23
56 0.25
57 0.22
58 0.23
59 0.23
60 0.26
61 0.29
62 0.3
63 0.29
64 0.36
65 0.44
66 0.51
67 0.58
68 0.61
69 0.63
70 0.69
71 0.74
72 0.74
73 0.74
74 0.76
75 0.76
76 0.78
77 0.85
78 0.79
79 0.8
80 0.78
81 0.77
82 0.72