Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550BS75

Protein Details
Accession A0A550BS75    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
137-161ISLVPLCRRQRSRRRPPRAFCSPRLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, extr 5, E.R. 3, nucl 1, mito 1, pero 1, vacu 1, mito_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR022535  Golgi_pH-regulator_cons_dom  
IPR015672  GPHR/GTG  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF12537  GPHR_N  
Amino Acid Sequences MSASAVLEHAAILCIRGGFFLGCRRYLIHSLYADLQDLSLPVGAAAETSSKSPSIELETLPMPSGASAQPPRSTLHFDDLARRIRELLSPRRARCFFLLLCQGMSMFQPRVVRLVQWKILSLALLLVNIILTIPSSISLVPLCRRQRSRRRPPRAFCSPRLLLNLIPVVLYLSALSYIPLPGALAPTGFVAGVLARLLRAGTTILGLLSGFGAISSAWPYLPFVNRAKSLPTEQDLRAAEHSLDRIRADLATLNGELTRTSASSTDGSWISRVATSFRGGDSRAQEMKGLRALEAEMSRNFDDLTRRYQEHTYRRTFRGRVVASALHLLFPSNAGYNTTTSDLLTDLLAIPCLLFVPGGSVGRDDLGLVGVIILMSLRLVLRGVTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.08
6 0.11
7 0.19
8 0.21
9 0.22
10 0.23
11 0.26
12 0.3
13 0.34
14 0.35
15 0.33
16 0.31
17 0.33
18 0.35
19 0.34
20 0.3
21 0.25
22 0.21
23 0.15
24 0.14
25 0.12
26 0.08
27 0.07
28 0.06
29 0.06
30 0.06
31 0.05
32 0.06
33 0.07
34 0.07
35 0.08
36 0.1
37 0.1
38 0.11
39 0.11
40 0.13
41 0.17
42 0.19
43 0.18
44 0.2
45 0.2
46 0.21
47 0.21
48 0.19
49 0.12
50 0.1
51 0.12
52 0.1
53 0.15
54 0.19
55 0.22
56 0.24
57 0.26
58 0.28
59 0.28
60 0.34
61 0.3
62 0.31
63 0.33
64 0.32
65 0.38
66 0.42
67 0.47
68 0.42
69 0.39
70 0.35
71 0.31
72 0.36
73 0.36
74 0.4
75 0.43
76 0.5
77 0.52
78 0.6
79 0.6
80 0.58
81 0.53
82 0.5
83 0.4
84 0.38
85 0.42
86 0.34
87 0.33
88 0.29
89 0.26
90 0.2
91 0.2
92 0.17
93 0.11
94 0.13
95 0.15
96 0.15
97 0.18
98 0.18
99 0.19
100 0.22
101 0.28
102 0.29
103 0.28
104 0.28
105 0.26
106 0.26
107 0.24
108 0.17
109 0.13
110 0.08
111 0.08
112 0.07
113 0.05
114 0.05
115 0.05
116 0.04
117 0.03
118 0.02
119 0.03
120 0.03
121 0.03
122 0.04
123 0.04
124 0.05
125 0.06
126 0.08
127 0.1
128 0.19
129 0.23
130 0.29
131 0.36
132 0.46
133 0.57
134 0.66
135 0.75
136 0.78
137 0.85
138 0.89
139 0.89
140 0.88
141 0.88
142 0.84
143 0.77
144 0.74
145 0.65
146 0.58
147 0.53
148 0.46
149 0.34
150 0.29
151 0.25
152 0.17
153 0.15
154 0.11
155 0.08
156 0.07
157 0.07
158 0.04
159 0.03
160 0.04
161 0.04
162 0.04
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.03
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.04
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.04
195 0.03
196 0.03
197 0.02
198 0.02
199 0.02
200 0.02
201 0.03
202 0.04
203 0.04
204 0.04
205 0.05
206 0.06
207 0.08
208 0.09
209 0.13
210 0.15
211 0.18
212 0.2
213 0.21
214 0.22
215 0.22
216 0.24
217 0.23
218 0.23
219 0.24
220 0.22
221 0.28
222 0.26
223 0.26
224 0.24
225 0.22
226 0.2
227 0.16
228 0.18
229 0.14
230 0.14
231 0.12
232 0.12
233 0.11
234 0.11
235 0.1
236 0.1
237 0.1
238 0.1
239 0.1
240 0.1
241 0.09
242 0.1
243 0.09
244 0.08
245 0.08
246 0.06
247 0.07
248 0.07
249 0.09
250 0.1
251 0.1
252 0.12
253 0.12
254 0.13
255 0.12
256 0.12
257 0.11
258 0.12
259 0.12
260 0.11
261 0.12
262 0.14
263 0.14
264 0.14
265 0.15
266 0.15
267 0.2
268 0.2
269 0.25
270 0.25
271 0.24
272 0.27
273 0.26
274 0.28
275 0.27
276 0.25
277 0.18
278 0.17
279 0.17
280 0.18
281 0.18
282 0.19
283 0.16
284 0.19
285 0.19
286 0.19
287 0.19
288 0.17
289 0.21
290 0.21
291 0.27
292 0.28
293 0.29
294 0.32
295 0.39
296 0.46
297 0.5
298 0.56
299 0.59
300 0.61
301 0.65
302 0.71
303 0.66
304 0.63
305 0.64
306 0.57
307 0.5
308 0.48
309 0.44
310 0.37
311 0.4
312 0.33
313 0.24
314 0.22
315 0.19
316 0.14
317 0.13
318 0.13
319 0.1
320 0.1
321 0.12
322 0.14
323 0.14
324 0.16
325 0.18
326 0.17
327 0.15
328 0.15
329 0.13
330 0.12
331 0.11
332 0.09
333 0.09
334 0.09
335 0.09
336 0.08
337 0.08
338 0.07
339 0.07
340 0.07
341 0.05
342 0.04
343 0.07
344 0.11
345 0.12
346 0.13
347 0.13
348 0.13
349 0.14
350 0.14
351 0.11
352 0.08
353 0.08
354 0.07
355 0.06
356 0.06
357 0.05
358 0.05
359 0.04
360 0.04
361 0.03
362 0.03
363 0.04
364 0.04
365 0.05
366 0.05