Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550C101

Protein Details
Accession A0A550C101    Localization Confidence High Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
21-67EPAVPVKRGRGRPKGSKNKPKDLALDPPVKVPKKRGRPPKAKPPPSEBasic
87-109GDADTDPPPPKRRRGRPRKNAEQBasic
NLS Segment(s)
PositionSequence
26-64VKRGRGRPKGSKNKPKDLALDPPVKVPKKRGRPPKAKPP
95-106PPKRRRGRPRKN
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MAKSSEKADATTSAAPAPEGEPAVPVKRGRGRPKGSKNKPKDLALDPPVKVPKKRGRPPKAKPPPSEDEDKGEGASGDAYKGEGASGDADTDPPPPKRRRGRPRKNAEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.16
4 0.14
5 0.12
6 0.11
7 0.1
8 0.1
9 0.12
10 0.15
11 0.17
12 0.17
13 0.22
14 0.29
15 0.38
16 0.45
17 0.53
18 0.59
19 0.66
20 0.76
21 0.81
22 0.84
23 0.86
24 0.85
25 0.85
26 0.83
27 0.76
28 0.7
29 0.62
30 0.59
31 0.54
32 0.52
33 0.42
34 0.41
35 0.44
36 0.41
37 0.38
38 0.38
39 0.41
40 0.46
41 0.54
42 0.61
43 0.65
44 0.73
45 0.8
46 0.83
47 0.85
48 0.84
49 0.79
50 0.76
51 0.72
52 0.65
53 0.64
54 0.54
55 0.48
56 0.42
57 0.38
58 0.31
59 0.25
60 0.21
61 0.14
62 0.14
63 0.08
64 0.06
65 0.05
66 0.06
67 0.06
68 0.05
69 0.05
70 0.04
71 0.05
72 0.06
73 0.06
74 0.07
75 0.07
76 0.08
77 0.09
78 0.13
79 0.17
80 0.22
81 0.3
82 0.35
83 0.45
84 0.55
85 0.66
86 0.74
87 0.8
88 0.86
89 0.89