Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DCZ5

Protein Details
Accession C5DCZ5   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
79-101KTAAKSSRKYRQYVNRKSKKLVQHydrophilic
NLS Segment(s)
PositionSequence
65-98KKVQGKGSGGKRVEKTAAKSSRKYRQYVNRKSKK
Subcellular Location(s) nucl 20.5, cyto_nucl 14.833, mito_nucl 11.832, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
KEGG lth:KLTH0B07062g  -  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MSSQSSPSKEASKPAAASPENPSAEKQKVESKPKGLQPASNESQPQPADVASLMGFASFGTTKQKKVQGKGSGGKRVEKTAAKSSRKYRQYVNRKSKKLVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.41
3 0.36
4 0.37
5 0.37
6 0.39
7 0.35
8 0.35
9 0.34
10 0.32
11 0.34
12 0.33
13 0.3
14 0.31
15 0.38
16 0.45
17 0.48
18 0.49
19 0.52
20 0.56
21 0.62
22 0.54
23 0.49
24 0.44
25 0.47
26 0.44
27 0.4
28 0.36
29 0.28
30 0.32
31 0.29
32 0.24
33 0.17
34 0.14
35 0.12
36 0.1
37 0.1
38 0.05
39 0.06
40 0.05
41 0.04
42 0.04
43 0.04
44 0.05
45 0.04
46 0.05
47 0.13
48 0.14
49 0.17
50 0.22
51 0.3
52 0.34
53 0.39
54 0.47
55 0.47
56 0.53
57 0.59
58 0.61
59 0.62
60 0.59
61 0.6
62 0.53
63 0.49
64 0.47
65 0.44
66 0.42
67 0.44
68 0.52
69 0.52
70 0.58
71 0.63
72 0.67
73 0.69
74 0.68
75 0.67
76 0.68
77 0.74
78 0.77
79 0.8
80 0.81
81 0.81