Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CFY9

Protein Details
Accession A0A550CFY9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
85-107YWGDPGYRMRHWRRGRRCHDICCHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, extr 4, mito 3, cyto 3, E.R. 3, vacu 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038213  IFI6/IFI27-like_sf  
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MDSTVAVTAGAVVAGVVLTPLLGPVVLGAAGFTAGGVAAGKLLRHYMSRIVLQNFHRQSGGWNAGRHWERDRRYCICWRSGCRSYWGDPGYRMRHWRRGRRCHDICC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.02
9 0.02
10 0.02
11 0.02
12 0.03
13 0.03
14 0.03
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.03
26 0.04
27 0.04
28 0.04
29 0.05
30 0.06
31 0.07
32 0.08
33 0.11
34 0.12
35 0.16
36 0.19
37 0.2
38 0.24
39 0.26
40 0.33
41 0.31
42 0.29
43 0.26
44 0.22
45 0.23
46 0.24
47 0.28
48 0.23
49 0.23
50 0.23
51 0.3
52 0.31
53 0.32
54 0.31
55 0.33
56 0.34
57 0.42
58 0.48
59 0.45
60 0.49
61 0.55
62 0.54
63 0.54
64 0.56
65 0.54
66 0.57
67 0.58
68 0.54
69 0.52
70 0.52
71 0.47
72 0.48
73 0.44
74 0.38
75 0.38
76 0.45
77 0.44
78 0.45
79 0.52
80 0.51
81 0.59
82 0.66
83 0.73
84 0.75
85 0.81
86 0.84
87 0.86