Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CZ97

Protein Details
Accession A0A550CZ97    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
18-41LSRAPCPSRMRKPARMLCRRPAHSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 11, extr 7, mito 4, E.R. 3
Family & Domain DBs
Amino Acid Sequences MQFFTVVAVVVFFLVNYLSRAPCPSRMRKPARMLCRRPAHSALVAAFEAAYHENSHRRQAPTTIRDAPPRRLDTYLSTGSFQHAPRTSSRCLPVRPRPLRLCVRLIDVSHPSPLKLQTCAFWSCQYHCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.07
4 0.09
5 0.09
6 0.11
7 0.15
8 0.17
9 0.26
10 0.33
11 0.41
12 0.49
13 0.59
14 0.67
15 0.72
16 0.79
17 0.79
18 0.82
19 0.83
20 0.8
21 0.79
22 0.81
23 0.75
24 0.71
25 0.65
26 0.58
27 0.49
28 0.45
29 0.35
30 0.28
31 0.24
32 0.18
33 0.14
34 0.1
35 0.09
36 0.08
37 0.08
38 0.06
39 0.08
40 0.13
41 0.14
42 0.2
43 0.24
44 0.25
45 0.25
46 0.31
47 0.37
48 0.36
49 0.4
50 0.4
51 0.37
52 0.44
53 0.46
54 0.45
55 0.44
56 0.44
57 0.41
58 0.36
59 0.36
60 0.32
61 0.34
62 0.32
63 0.26
64 0.24
65 0.22
66 0.22
67 0.24
68 0.21
69 0.22
70 0.2
71 0.22
72 0.25
73 0.3
74 0.31
75 0.32
76 0.38
77 0.37
78 0.4
79 0.47
80 0.53
81 0.59
82 0.62
83 0.66
84 0.65
85 0.68
86 0.71
87 0.67
88 0.62
89 0.53
90 0.53
91 0.47
92 0.44
93 0.4
94 0.37
95 0.33
96 0.34
97 0.32
98 0.27
99 0.27
100 0.31
101 0.29
102 0.27
103 0.27
104 0.25
105 0.29
106 0.31
107 0.31
108 0.31
109 0.33