Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C5DCX0

Protein Details
Accession C5DCX0   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-32VNVPKTRRTYCKGKQCRKHTQHKVTQYKAGKHydrophilic
NLS Segment(s)
PositionSequence
41-63RRYDRKQRGFGGQTRPIFHKKAK
Subcellular Location(s) nucl 11, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lth:KLTH0B06446g  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRRTYCKGKQCRKHTQHKVTQYKAGKASLYAQGKRRYDRKQRGFGGQTRPIFHKKAKVTKKVVLRLECVVCKTRAQLALKRCKHFELGGEKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.9
5 0.89
6 0.91
7 0.91
8 0.9
9 0.89
10 0.89
11 0.89
12 0.82
13 0.82
14 0.75
15 0.7
16 0.62
17 0.55
18 0.44
19 0.35
20 0.34
21 0.33
22 0.34
23 0.32
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.54
30 0.59
31 0.66
32 0.69
33 0.7
34 0.7
35 0.72
36 0.7
37 0.66
38 0.63
39 0.59
40 0.52
41 0.45
42 0.45
43 0.41
44 0.39
45 0.36
46 0.36
47 0.36
48 0.44
49 0.5
50 0.56
51 0.58
52 0.61
53 0.67
54 0.67
55 0.67
56 0.6
57 0.54
58 0.5
59 0.47
60 0.43
61 0.37
62 0.33
63 0.27
64 0.25
65 0.25
66 0.25
67 0.28
68 0.31
69 0.35
70 0.41
71 0.51
72 0.57
73 0.6
74 0.58
75 0.54
76 0.53
77 0.49
78 0.46
79 0.46
80 0.48
81 0.53
82 0.59
83 0.57
84 0.58
85 0.61
86 0.57