Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550CV00

Protein Details
Accession A0A550CV00    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20RKKRAKKEKDPNAPKRPATSBasic
NLS Segment(s)
PositionSequence
1-16RKKRAKKEKDPNAPKR
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences RKKRAKKEKDPNAPKRPATSYILYQNDCRALMKEQNPGLHNTDLLRHISDTWKALPEKEKAAYEAKAAQLKDVYAETVKEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.77
3 0.7
4 0.64
5 0.57
6 0.51
7 0.45
8 0.46
9 0.48
10 0.43
11 0.39
12 0.37
13 0.34
14 0.3
15 0.26
16 0.19
17 0.17
18 0.22
19 0.25
20 0.28
21 0.29
22 0.32
23 0.32
24 0.33
25 0.33
26 0.27
27 0.24
28 0.18
29 0.18
30 0.15
31 0.15
32 0.13
33 0.1
34 0.11
35 0.13
36 0.14
37 0.14
38 0.14
39 0.18
40 0.18
41 0.2
42 0.24
43 0.25
44 0.28
45 0.29
46 0.29
47 0.27
48 0.3
49 0.28
50 0.26
51 0.27
52 0.27
53 0.28
54 0.27
55 0.26
56 0.24
57 0.23
58 0.23
59 0.2
60 0.18
61 0.15