Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550CXW6

Protein Details
Accession A0A550CXW6    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-121YQPSQRVRKRRHGFLSRLRTKNGRRILRLRLKKGRKSLSHBasic
NLS Segment(s)
PositionSequence
87-119RVRKRRHGFLSRLRTKNGRRILRLRLKKGRKSL
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPRHLLSLLSRPVRSAALPAPTHVAPVSCAQVTRLAATRPFLAQARPQISMTPSSMLASLSPSLSGLQQLRFRTFGTEYQPSQRVRKRRHGFLSRLRTKNGRRILRLRLKKGRKSLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.35
4 0.3
5 0.26
6 0.22
7 0.24
8 0.25
9 0.25
10 0.27
11 0.26
12 0.26
13 0.22
14 0.19
15 0.13
16 0.14
17 0.16
18 0.12
19 0.12
20 0.12
21 0.16
22 0.16
23 0.16
24 0.17
25 0.15
26 0.16
27 0.18
28 0.18
29 0.14
30 0.16
31 0.15
32 0.14
33 0.16
34 0.22
35 0.23
36 0.23
37 0.23
38 0.22
39 0.23
40 0.23
41 0.2
42 0.15
43 0.12
44 0.11
45 0.11
46 0.1
47 0.08
48 0.08
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.08
56 0.08
57 0.11
58 0.16
59 0.18
60 0.19
61 0.2
62 0.2
63 0.21
64 0.21
65 0.21
66 0.23
67 0.26
68 0.26
69 0.31
70 0.36
71 0.36
72 0.43
73 0.46
74 0.5
75 0.52
76 0.62
77 0.65
78 0.69
79 0.76
80 0.77
81 0.8
82 0.81
83 0.84
84 0.83
85 0.79
86 0.74
87 0.73
88 0.7
89 0.71
90 0.7
91 0.68
92 0.66
93 0.69
94 0.75
95 0.77
96 0.81
97 0.81
98 0.82
99 0.84
100 0.85
101 0.88