Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550BTF1

Protein Details
Accession A0A550BTF1    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
41-70GPIARGRRARGRRLRERKARRERRGLSEFVBasic
NLS Segment(s)
PositionSequence
43-64IARGRRARGRRLRERKARRERR
Subcellular Location(s) mito 11, plas 4, extr 4, cyto 3, pero 2, nucl 1, E.R. 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MVWERSQMSTFFLFVGKLLLIFRQRGGGARGEVSDEFRALGPIARGRRARGRRLRERKARRERRGLSEFVVAMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.09
4 0.08
5 0.08
6 0.1
7 0.12
8 0.13
9 0.13
10 0.14
11 0.14
12 0.16
13 0.17
14 0.17
15 0.15
16 0.15
17 0.15
18 0.14
19 0.14
20 0.15
21 0.13
22 0.1
23 0.1
24 0.09
25 0.09
26 0.07
27 0.08
28 0.07
29 0.11
30 0.13
31 0.18
32 0.2
33 0.23
34 0.33
35 0.38
36 0.47
37 0.52
38 0.61
39 0.67
40 0.76
41 0.84
42 0.85
43 0.9
44 0.9
45 0.92
46 0.93
47 0.92
48 0.92
49 0.88
50 0.87
51 0.82
52 0.75
53 0.67
54 0.61