Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CNH4

Protein Details
Accession A0A550CNH4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
65-84LAVPKKKTSHSKKRMRASGKBasic
NLS Segment(s)
PositionSequence
69-87KKKTSHSKKRMRASGKGLK
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MAALALARPAFQLPALRAPLWRPLFASWAISTALPSWRTPSAPSPTWDIRARLQSLLELLPGIVLAVPKKKTSHSKKRMRASGKGLKDKQNIVSCPGCGSPKLAHHLCGKCYGFLSKLWRGKFHRHGDMPDMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.25
3 0.25
4 0.26
5 0.27
6 0.35
7 0.34
8 0.32
9 0.27
10 0.25
11 0.28
12 0.27
13 0.28
14 0.19
15 0.18
16 0.17
17 0.15
18 0.14
19 0.13
20 0.16
21 0.15
22 0.15
23 0.17
24 0.17
25 0.18
26 0.2
27 0.25
28 0.27
29 0.29
30 0.3
31 0.33
32 0.33
33 0.38
34 0.38
35 0.34
36 0.31
37 0.33
38 0.33
39 0.27
40 0.26
41 0.21
42 0.19
43 0.17
44 0.13
45 0.08
46 0.06
47 0.05
48 0.05
49 0.04
50 0.03
51 0.03
52 0.04
53 0.08
54 0.09
55 0.1
56 0.12
57 0.16
58 0.26
59 0.36
60 0.47
61 0.54
62 0.63
63 0.71
64 0.79
65 0.84
66 0.8
67 0.76
68 0.74
69 0.72
70 0.7
71 0.71
72 0.67
73 0.66
74 0.64
75 0.61
76 0.58
77 0.56
78 0.49
79 0.44
80 0.41
81 0.33
82 0.31
83 0.3
84 0.24
85 0.18
86 0.2
87 0.19
88 0.21
89 0.29
90 0.28
91 0.3
92 0.37
93 0.41
94 0.39
95 0.44
96 0.41
97 0.34
98 0.35
99 0.33
100 0.27
101 0.27
102 0.33
103 0.34
104 0.39
105 0.41
106 0.48
107 0.51
108 0.6
109 0.65
110 0.67
111 0.68
112 0.66
113 0.68