Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CNM2

Protein Details
Accession A0A550CNM2   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-46VASIPIVKKRTKPFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-51KKRTKPFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQTPMP
Subcellular Location(s) mito 16.5, mito_nucl 13, nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVASIPIVKKRTKPFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQTPMPKIGYGSNKKTRHVLPNGLKKFLVSNIREMDLLLMHNKSYSAEIAHNVSSRNRTAILERAKVLGVKVTNSAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.82
3 0.89
4 0.91
5 0.9
6 0.9
7 0.87
8 0.85
9 0.82
10 0.74
11 0.64
12 0.59
13 0.57
14 0.56
15 0.58
16 0.59
17 0.54
18 0.52
19 0.53
20 0.58
21 0.61
22 0.62
23 0.62
24 0.63
25 0.71
26 0.8
27 0.84
28 0.77
29 0.75
30 0.71
31 0.69
32 0.69
33 0.66
34 0.67
35 0.68
36 0.71
37 0.64
38 0.58
39 0.51
40 0.45
41 0.45
42 0.4
43 0.4
44 0.44
45 0.45
46 0.45
47 0.49
48 0.48
49 0.47
50 0.45
51 0.47
52 0.45
53 0.53
54 0.54
55 0.52
56 0.47
57 0.4
58 0.36
59 0.32
60 0.31
61 0.22
62 0.25
63 0.25
64 0.26
65 0.25
66 0.24
67 0.2
68 0.13
69 0.13
70 0.1
71 0.09
72 0.08
73 0.08
74 0.08
75 0.08
76 0.09
77 0.09
78 0.09
79 0.1
80 0.12
81 0.14
82 0.16
83 0.16
84 0.17
85 0.19
86 0.21
87 0.21
88 0.21
89 0.2
90 0.19
91 0.22
92 0.29
93 0.33
94 0.33
95 0.33
96 0.33
97 0.32
98 0.31
99 0.29
100 0.26
101 0.2
102 0.18
103 0.19
104 0.21
105 0.22
106 0.23
107 0.26
108 0.23