Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CA68

Protein Details
Accession A0A550CA68    Localization Confidence High Confidence Score 18.3
NoLS Segment(s)
PositionSequenceProtein Nature
67-95PAAPAPKRKAPTKPRTPRKEKDDPKAPKIBasic
258-277PLEKTHRKVRHWRVAHRQISBasic
NLS Segment(s)
PositionSequence
71-95APKRKAPTKPRTPRKEKDDPKAPKI
130-157VPAKRKPAAKKTPAANGKNKAKRPRTSK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDAPTISTLHEEQTPPPTASARGTGPTRVKLVMSKEQHAPAVKREQGSDMEDDETDQLIDELDDDEPAAPAPKRKAPTKPRTPRKEKDDPKAPKIIIPPVPRPVDPPPAMPAPVELVPAVSASNTPPKTVPAKRKPAAKKTPAANGKNKAKRPRTSKASTSRAGDETDRMSEAGYTATAASSPGNTMFSGHTPEPEQHAPTPNHHTPMSAPPQIPPPQLPLAEPAEPMGPVPVYPLPTKPFPVMPPPKMGSGFLPVIPLEKTHRKVRHWRVAHRQISGIAGGRWYARAWAGERRSELADTVAKRAGAMSASVSAAHTRAGSQTLALGSRSSTTSASAPVAMQGMSGVPAPPRRAGSSLAPSASASRSSSAIPDGSISATMTRQPSKMRIAQMAPGSERSASSSVPPPDQDTEMLGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.3
4 0.3
5 0.28
6 0.29
7 0.3
8 0.26
9 0.27
10 0.28
11 0.34
12 0.38
13 0.39
14 0.39
15 0.37
16 0.36
17 0.35
18 0.4
19 0.42
20 0.42
21 0.43
22 0.46
23 0.47
24 0.5
25 0.51
26 0.47
27 0.44
28 0.48
29 0.49
30 0.45
31 0.43
32 0.42
33 0.4
34 0.4
35 0.36
36 0.28
37 0.25
38 0.23
39 0.23
40 0.2
41 0.17
42 0.13
43 0.1
44 0.08
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.1
56 0.1
57 0.15
58 0.2
59 0.27
60 0.32
61 0.38
62 0.49
63 0.56
64 0.66
65 0.72
66 0.79
67 0.83
68 0.89
69 0.92
70 0.91
71 0.89
72 0.9
73 0.87
74 0.87
75 0.86
76 0.84
77 0.8
78 0.79
79 0.7
80 0.63
81 0.58
82 0.56
83 0.53
84 0.51
85 0.5
86 0.49
87 0.52
88 0.47
89 0.47
90 0.45
91 0.46
92 0.41
93 0.38
94 0.35
95 0.34
96 0.34
97 0.29
98 0.25
99 0.19
100 0.18
101 0.16
102 0.12
103 0.1
104 0.09
105 0.09
106 0.09
107 0.06
108 0.06
109 0.07
110 0.15
111 0.15
112 0.16
113 0.17
114 0.2
115 0.28
116 0.35
117 0.45
118 0.46
119 0.56
120 0.6
121 0.69
122 0.75
123 0.77
124 0.8
125 0.77
126 0.74
127 0.68
128 0.73
129 0.73
130 0.7
131 0.68
132 0.66
133 0.69
134 0.7
135 0.73
136 0.73
137 0.73
138 0.74
139 0.74
140 0.75
141 0.74
142 0.72
143 0.74
144 0.74
145 0.72
146 0.67
147 0.62
148 0.55
149 0.48
150 0.43
151 0.35
152 0.27
153 0.22
154 0.19
155 0.16
156 0.13
157 0.12
158 0.1
159 0.09
160 0.07
161 0.06
162 0.05
163 0.04
164 0.04
165 0.04
166 0.05
167 0.04
168 0.04
169 0.05
170 0.05
171 0.06
172 0.06
173 0.07
174 0.08
175 0.08
176 0.12
177 0.12
178 0.12
179 0.12
180 0.13
181 0.17
182 0.17
183 0.19
184 0.17
185 0.23
186 0.24
187 0.26
188 0.33
189 0.3
190 0.32
191 0.3
192 0.28
193 0.24
194 0.29
195 0.31
196 0.27
197 0.25
198 0.23
199 0.29
200 0.32
201 0.31
202 0.25
203 0.23
204 0.22
205 0.22
206 0.22
207 0.19
208 0.19
209 0.19
210 0.18
211 0.14
212 0.12
213 0.12
214 0.11
215 0.08
216 0.05
217 0.04
218 0.07
219 0.07
220 0.09
221 0.1
222 0.12
223 0.15
224 0.16
225 0.18
226 0.18
227 0.19
228 0.18
229 0.28
230 0.33
231 0.32
232 0.37
233 0.36
234 0.37
235 0.36
236 0.35
237 0.26
238 0.22
239 0.21
240 0.16
241 0.15
242 0.13
243 0.13
244 0.13
245 0.13
246 0.14
247 0.2
248 0.24
249 0.32
250 0.39
251 0.44
252 0.55
253 0.64
254 0.69
255 0.69
256 0.74
257 0.76
258 0.81
259 0.79
260 0.7
261 0.61
262 0.52
263 0.45
264 0.37
265 0.28
266 0.17
267 0.13
268 0.12
269 0.11
270 0.1
271 0.09
272 0.09
273 0.08
274 0.1
275 0.13
276 0.2
277 0.23
278 0.26
279 0.28
280 0.29
281 0.29
282 0.28
283 0.26
284 0.21
285 0.22
286 0.2
287 0.22
288 0.21
289 0.19
290 0.19
291 0.18
292 0.16
293 0.11
294 0.1
295 0.08
296 0.08
297 0.09
298 0.09
299 0.09
300 0.09
301 0.09
302 0.09
303 0.08
304 0.07
305 0.08
306 0.1
307 0.1
308 0.09
309 0.11
310 0.11
311 0.12
312 0.12
313 0.11
314 0.1
315 0.11
316 0.12
317 0.12
318 0.11
319 0.12
320 0.12
321 0.14
322 0.15
323 0.14
324 0.13
325 0.12
326 0.13
327 0.11
328 0.09
329 0.08
330 0.07
331 0.07
332 0.07
333 0.07
334 0.09
335 0.14
336 0.16
337 0.19
338 0.22
339 0.24
340 0.26
341 0.29
342 0.32
343 0.36
344 0.38
345 0.35
346 0.33
347 0.31
348 0.31
349 0.29
350 0.24
351 0.18
352 0.15
353 0.16
354 0.16
355 0.17
356 0.18
357 0.16
358 0.14
359 0.14
360 0.14
361 0.13
362 0.13
363 0.12
364 0.11
365 0.12
366 0.16
367 0.19
368 0.22
369 0.24
370 0.28
371 0.33
372 0.39
373 0.45
374 0.46
375 0.48
376 0.48
377 0.51
378 0.51
379 0.51
380 0.45
381 0.41
382 0.37
383 0.31
384 0.29
385 0.27
386 0.24
387 0.2
388 0.22
389 0.28
390 0.3
391 0.33
392 0.34
393 0.35
394 0.36
395 0.38
396 0.35