Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550CJ73

Protein Details
Accession A0A550CJ73    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-36TKTRRKAAAKSEKTPRKAKKDPNAPKRALSHydrophilic
NLS Segment(s)
PositionSequence
7-33TKTRRKAAAKSEKTPRKAKKDPNAPKR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEPATKTRRKAAAKSEKTPRKAKKDPNAPKRALSAYMFFSQDWRERVKTENPDASFGELGKILGAKWKEMDEDEKKPYVEKASKDKERAEADKAAYDEKKSAEASEADEDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.77
4 0.79
5 0.78
6 0.78
7 0.81
8 0.8
9 0.78
10 0.79
11 0.81
12 0.81
13 0.83
14 0.88
15 0.88
16 0.88
17 0.81
18 0.74
19 0.67
20 0.59
21 0.51
22 0.42
23 0.33
24 0.27
25 0.27
26 0.26
27 0.21
28 0.2
29 0.2
30 0.22
31 0.21
32 0.21
33 0.2
34 0.2
35 0.25
36 0.3
37 0.34
38 0.35
39 0.39
40 0.36
41 0.37
42 0.37
43 0.34
44 0.27
45 0.2
46 0.16
47 0.1
48 0.09
49 0.06
50 0.06
51 0.04
52 0.08
53 0.09
54 0.09
55 0.09
56 0.1
57 0.11
58 0.12
59 0.2
60 0.21
61 0.26
62 0.29
63 0.3
64 0.29
65 0.3
66 0.3
67 0.31
68 0.31
69 0.31
70 0.37
71 0.45
72 0.52
73 0.55
74 0.56
75 0.56
76 0.57
77 0.56
78 0.5
79 0.46
80 0.41
81 0.41
82 0.39
83 0.37
84 0.32
85 0.3
86 0.28
87 0.24
88 0.26
89 0.22
90 0.22
91 0.2
92 0.2
93 0.22
94 0.25
95 0.24