FuNGI

A0A550C757

Protein Details

Accession

A0A550C757

Localization Confidence

Medium

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
179-200	RPQLPRKKLTPSPKNCKPQPRE	Hydrophilic

NLS Segment(s)

Position	Sequence
226-271	PVPKKNQVPAGGKGVPPRAGANKLPSPVGGKQRPMPAGPKAPRPAP

Subcellular Location(s)

cyto 11, mito 9, nucl 5

Family & Domain DBs

InterPro	View protein in InterPro IPR011009 Kinase-like_dom_sf IPR000719 Prot_kinase_dom
Gene Ontology	GO:0005524 F:ATP binding GO:0004672 F:protein kinase activity GO:0006468 P:protein phosphorylation
Pfam	View protein in Pfam PF00069 Pkinase
PROSITE	View protein in PROSITE PS50011 PROTEIN_KINASE_DOM

Amino Acid Sequences

MKNWYLSDFGLATNAAFSSQIGIGTSYFMAPEVLGTREFYRESIWHAAGDVWALGMTLCAAAFNGFPWQRADRKDKKFAKFLEAPEAQLIEALPFSRPLAILLVDVFAVDSERRTTTTEFARRLATIPTLYNSSVPDRHSPAGRAEAACARYTPLYKRPTKSRSVYGIISYVPTSSQLRPQLPRKKLTPSPKNCKPQPREVLLTVPRKEPVGPGRTCSPHGPRGLPVPKKNQVPAGGKGVPPRAGANKLPSPVGGKQRPMPAGPKAPRPAPIHIHAPVPVVPRRAPSLLGPPPLPPLPRFQHAPPANGPPVPTLLEFMSNPNRVYSPDIPKYFAEVAAIVDGRRREAIGARPLPTPGEQHRALPDIAAYLQAPSPVDPPAPSPVELQTRPLLPPLPTPPRLLTAPRFGMPPLPTPPRLRVPPFPMPELVRGLPTAEETPLVTPETRPMDAPGMLEVPPMALDGRWNEREERQMVVPEGARQTLKMLGAQEAKIFAAEAMEVEVLKAEVRVQKPLKVEVTASYNCGDYVDVNLLMGLQPGTIV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.12
2	0.09
3	0.08
4	0.08
5	0.09
6	0.1
7	0.1
8	0.1
9	0.11
10	0.11
11	0.12
12	0.13
13	0.1
14	0.09
15	0.09
16	0.09
17	0.07
18	0.09
19	0.09
20	0.11
21	0.11
22	0.14
23	0.15
24	0.18
25	0.19
26	0.18
27	0.19
28	0.19
29	0.24
30	0.29
31	0.28
32	0.25
33	0.25
34	0.25
35	0.21
36	0.21
37	0.14
38	0.08
39	0.07
40	0.06
41	0.05
42	0.05
43	0.04
44	0.04
45	0.04
46	0.04
47	0.04
48	0.05
49	0.05
50	0.06
51	0.14
52	0.15
53	0.16
54	0.2
55	0.25
56	0.3
57	0.37
58	0.47
59	0.49
60	0.57
61	0.67
62	0.72
63	0.74
64	0.77
65	0.73
66	0.72
67	0.69
68	0.63
69	0.62
70	0.54
71	0.49
72	0.42
73	0.39
74	0.29
75	0.23
76	0.2
77	0.1
78	0.1
79	0.09
80	0.07
81	0.08
82	0.08
83	0.09
84	0.09
85	0.09
86	0.1
87	0.1
88	0.1
89	0.1
90	0.1
91	0.08
92	0.08
93	0.07
94	0.05
95	0.06
96	0.06
97	0.06
98	0.08
99	0.09
100	0.11
101	0.14
102	0.16
103	0.2
104	0.29
105	0.35
106	0.36
107	0.37
108	0.38
109	0.35
110	0.35
111	0.33
112	0.26
113	0.2
114	0.19
115	0.19
116	0.2
117	0.2
118	0.19
119	0.19
120	0.2
121	0.21
122	0.23
123	0.25
124	0.27
125	0.3
126	0.31
127	0.31
128	0.3
129	0.32
130	0.32
131	0.28
132	0.26
133	0.28
134	0.27
135	0.26
136	0.23
137	0.19
138	0.18
139	0.21
140	0.23
141	0.26
142	0.33
143	0.4
144	0.46
145	0.54
146	0.58
147	0.64
148	0.64
149	0.63
150	0.61
151	0.58
152	0.54
153	0.46
154	0.41
155	0.33
156	0.29
157	0.21
158	0.15
159	0.11
160	0.11
161	0.13
162	0.12
163	0.18
164	0.23
165	0.27
166	0.34
167	0.44
168	0.51
169	0.54
170	0.58
171	0.56
172	0.58
173	0.62
174	0.66
175	0.67
176	0.68
177	0.72
178	0.76
179	0.82
180	0.81
181	0.83
182	0.78
183	0.78
184	0.76
185	0.71
186	0.66
187	0.58
188	0.59
189	0.56
190	0.58
191	0.49
192	0.42
193	0.37
194	0.33
195	0.32
196	0.29
197	0.29
198	0.29
199	0.28
200	0.29
201	0.34
202	0.35
203	0.37
204	0.37
205	0.35
206	0.33
207	0.35
208	0.34
209	0.3
210	0.37
211	0.43
212	0.45
213	0.45
214	0.48
215	0.51
216	0.53
217	0.53
218	0.48
219	0.47
220	0.45
221	0.42
222	0.4
223	0.36
224	0.35
225	0.36
226	0.34
227	0.28
228	0.24
229	0.23
230	0.19
231	0.21
232	0.21
233	0.23
234	0.24
235	0.24
236	0.23
237	0.22
238	0.23
239	0.24
240	0.31
241	0.28
242	0.27
243	0.3
244	0.35
245	0.36
246	0.33
247	0.32
248	0.28
249	0.34
250	0.35
251	0.38
252	0.36
253	0.36
254	0.41
255	0.41
256	0.41
257	0.36
258	0.37
259	0.34
260	0.32
261	0.32
262	0.25
263	0.23
264	0.22
265	0.21
266	0.2
267	0.19
268	0.18
269	0.18
270	0.2
271	0.2
272	0.18
273	0.16
274	0.22
275	0.23
276	0.25
277	0.24
278	0.22
279	0.24
280	0.25
281	0.24
282	0.17
283	0.2
284	0.21
285	0.23
286	0.26
287	0.24
288	0.33
289	0.34
290	0.36
291	0.32
292	0.35
293	0.33
294	0.31
295	0.3
296	0.21
297	0.2
298	0.18
299	0.16
300	0.11
301	0.1
302	0.11
303	0.11
304	0.14
305	0.19
306	0.2
307	0.2
308	0.19
309	0.19
310	0.19
311	0.24
312	0.27
313	0.29
314	0.34
315	0.35
316	0.37
317	0.36
318	0.39
319	0.34
320	0.28
321	0.2
322	0.13
323	0.12
324	0.11
325	0.12
326	0.07
327	0.09
328	0.09
329	0.1
330	0.09
331	0.09
332	0.09
333	0.12
334	0.19
335	0.25
336	0.29
337	0.3
338	0.31
339	0.31
340	0.31
341	0.29
342	0.27
343	0.22
344	0.25
345	0.23
346	0.25
347	0.26
348	0.27
349	0.26
350	0.22
351	0.18
352	0.12
353	0.12
354	0.11
355	0.09
356	0.07
357	0.07
358	0.08
359	0.08
360	0.08
361	0.09
362	0.09
363	0.1
364	0.09
365	0.11
366	0.15
367	0.17
368	0.17
369	0.18
370	0.21
371	0.27
372	0.27
373	0.28
374	0.25
375	0.25
376	0.25
377	0.25
378	0.24
379	0.18
380	0.23
381	0.28
382	0.33
383	0.34
384	0.36
385	0.36
386	0.37
387	0.38
388	0.38
389	0.34
390	0.34
391	0.35
392	0.33
393	0.32
394	0.29
395	0.32
396	0.29
397	0.3
398	0.29
399	0.31
400	0.34
401	0.37
402	0.42
403	0.44
404	0.49
405	0.49
406	0.5
407	0.53
408	0.58
409	0.58
410	0.55
411	0.51
412	0.47
413	0.45
414	0.42
415	0.35
416	0.27
417	0.23
418	0.21
419	0.18
420	0.18
421	0.16
422	0.11
423	0.11
424	0.11
425	0.12
426	0.12
427	0.14
428	0.12
429	0.11
430	0.17
431	0.21
432	0.21
433	0.21
434	0.22
435	0.24
436	0.24
437	0.24
438	0.2
439	0.17
440	0.16
441	0.15
442	0.12
443	0.09
444	0.08
445	0.08
446	0.07
447	0.05
448	0.08
449	0.12
450	0.19
451	0.22
452	0.24
453	0.27
454	0.3
455	0.37
456	0.36
457	0.36
458	0.31
459	0.32
460	0.32
461	0.32
462	0.3
463	0.28
464	0.29
465	0.28
466	0.25
467	0.21
468	0.22
469	0.21
470	0.21
471	0.19
472	0.18
473	0.22
474	0.25
475	0.26
476	0.25
477	0.22
478	0.22
479	0.19
480	0.18
481	0.12
482	0.09
483	0.08
484	0.07
485	0.07
486	0.07
487	0.07
488	0.07
489	0.07
490	0.07
491	0.07
492	0.07
493	0.1
494	0.17
495	0.19
496	0.28
497	0.31
498	0.35
499	0.39
500	0.46
501	0.45
502	0.4
503	0.4
504	0.34
505	0.39
506	0.36
507	0.34
508	0.28
509	0.25
510	0.23
511	0.22
512	0.18
513	0.11
514	0.13
515	0.15
516	0.14
517	0.13
518	0.13
519	0.13
520	0.12
521	0.13
522	0.09

A0A550C757

3D AlphaFold-predicted Structure Viewer