Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CV23

Protein Details
Accession A0A550CV23   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-43SLPWCQPGTRSPHGRKKKKKKQPLCQAIHIRERKHydrophilic
NLS Segment(s)
PositionSequence
20-30SPHGRKKKKKK
Subcellular Location(s) mito 10.5, cyto_mito 8.333, extr 6, cyto_nucl 5.833, nucl 5.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MLCPPPHIGSLPWCQPGTRSPHGRKKKKKKQPLCQAIHIRERKETYKLCAIASSTAQHEKVADQDPFSGPSRAPTEQAHFSLLSSPRSSTHNQTAKGQKVGGLGVAPKTVETQRCTAPSRPPSQGACNIDEPHAYPIVYVQVPAHTAPQHPTYSKAGTLPPVPGMADHGAPSPLPAGLVSNTTTVPLAAAPPGFGNSGAPPPPLQPTQVPLPLPVAALPAPIAAPSSPQPPPAGGGGAAATVVLQPPQAATNTAAQAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.4
4 0.42
5 0.43
6 0.48
7 0.53
8 0.63
9 0.74
10 0.83
11 0.88
12 0.91
13 0.93
14 0.94
15 0.95
16 0.95
17 0.95
18 0.96
19 0.96
20 0.91
21 0.9
22 0.89
23 0.85
24 0.85
25 0.79
26 0.7
27 0.65
28 0.63
29 0.57
30 0.55
31 0.51
32 0.47
33 0.5
34 0.49
35 0.43
36 0.4
37 0.37
38 0.31
39 0.3
40 0.25
41 0.2
42 0.22
43 0.22
44 0.2
45 0.2
46 0.18
47 0.2
48 0.23
49 0.21
50 0.18
51 0.2
52 0.2
53 0.23
54 0.25
55 0.21
56 0.16
57 0.2
58 0.24
59 0.22
60 0.24
61 0.23
62 0.25
63 0.28
64 0.29
65 0.27
66 0.22
67 0.21
68 0.25
69 0.25
70 0.22
71 0.19
72 0.19
73 0.18
74 0.22
75 0.25
76 0.24
77 0.32
78 0.35
79 0.36
80 0.42
81 0.48
82 0.48
83 0.47
84 0.42
85 0.34
86 0.29
87 0.27
88 0.21
89 0.14
90 0.11
91 0.1
92 0.1
93 0.08
94 0.07
95 0.08
96 0.11
97 0.13
98 0.15
99 0.17
100 0.19
101 0.22
102 0.26
103 0.27
104 0.33
105 0.36
106 0.38
107 0.38
108 0.4
109 0.38
110 0.38
111 0.41
112 0.36
113 0.33
114 0.3
115 0.29
116 0.26
117 0.24
118 0.21
119 0.16
120 0.13
121 0.11
122 0.08
123 0.07
124 0.09
125 0.09
126 0.08
127 0.07
128 0.07
129 0.08
130 0.09
131 0.1
132 0.09
133 0.1
134 0.12
135 0.15
136 0.17
137 0.16
138 0.19
139 0.21
140 0.21
141 0.21
142 0.2
143 0.18
144 0.18
145 0.19
146 0.17
147 0.14
148 0.13
149 0.12
150 0.11
151 0.12
152 0.11
153 0.1
154 0.1
155 0.1
156 0.09
157 0.09
158 0.1
159 0.07
160 0.06
161 0.06
162 0.05
163 0.06
164 0.06
165 0.08
166 0.09
167 0.09
168 0.09
169 0.1
170 0.1
171 0.08
172 0.08
173 0.07
174 0.06
175 0.06
176 0.06
177 0.06
178 0.07
179 0.08
180 0.08
181 0.08
182 0.08
183 0.09
184 0.13
185 0.13
186 0.14
187 0.14
188 0.15
189 0.19
190 0.19
191 0.21
192 0.18
193 0.21
194 0.26
195 0.3
196 0.29
197 0.25
198 0.27
199 0.24
200 0.23
201 0.2
202 0.16
203 0.12
204 0.11
205 0.1
206 0.08
207 0.08
208 0.07
209 0.08
210 0.06
211 0.09
212 0.11
213 0.16
214 0.17
215 0.19
216 0.2
217 0.19
218 0.22
219 0.2
220 0.2
221 0.15
222 0.14
223 0.13
224 0.11
225 0.1
226 0.08
227 0.06
228 0.05
229 0.06
230 0.05
231 0.05
232 0.05
233 0.06
234 0.08
235 0.1
236 0.11
237 0.13
238 0.18