Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550BTA4

Protein Details
Accession A0A550BTA4   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
93-114GRQRLCDGRRVRRTGRRPRAVLBasic
NLS Segment(s)
Subcellular Location(s) mito 10, extr 8, plas 3, golg 3, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEYNAARTRRFVSQNLSYIIIFSAVVVFARIYTSRTLISLSTVPEEIVEVDPHPIPQLIVEAFERILARQSRTLEDAAAEYRAIPQRVSTSGGRQRLCDGRRVRRTGRRPRAVLEISGEELAHRALQVRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.49
3 0.47
4 0.39
5 0.35
6 0.3
7 0.23
8 0.15
9 0.1
10 0.08
11 0.05
12 0.06
13 0.05
14 0.05
15 0.05
16 0.07
17 0.07
18 0.08
19 0.09
20 0.11
21 0.11
22 0.11
23 0.12
24 0.11
25 0.13
26 0.13
27 0.13
28 0.13
29 0.12
30 0.12
31 0.11
32 0.11
33 0.1
34 0.09
35 0.08
36 0.07
37 0.08
38 0.09
39 0.09
40 0.09
41 0.07
42 0.06
43 0.06
44 0.07
45 0.06
46 0.07
47 0.07
48 0.07
49 0.07
50 0.08
51 0.08
52 0.06
53 0.11
54 0.11
55 0.12
56 0.15
57 0.17
58 0.17
59 0.19
60 0.19
61 0.15
62 0.14
63 0.14
64 0.11
65 0.1
66 0.09
67 0.07
68 0.1
69 0.14
70 0.14
71 0.13
72 0.13
73 0.15
74 0.16
75 0.2
76 0.18
77 0.23
78 0.3
79 0.37
80 0.37
81 0.35
82 0.39
83 0.43
84 0.43
85 0.43
86 0.45
87 0.48
88 0.57
89 0.63
90 0.67
91 0.69
92 0.79
93 0.81
94 0.84
95 0.83
96 0.77
97 0.74
98 0.75
99 0.67
100 0.59
101 0.52
102 0.44
103 0.36
104 0.33
105 0.29
106 0.2
107 0.18
108 0.16
109 0.12
110 0.09