Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550BRD4

Protein Details
Accession A0A550BRD4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
41-71HAPRRIRGRRVAPRRIRGRRVDPRRIRWRVLBasic
127-146HHPPRRCGLHHPPRARHPGABasic
NLS Segment(s)
PositionSequence
27-68SPPRPRPPALPPPLHAPRRIRGRRVAPRRIRGRRVDPRRIRW
Subcellular Location(s) mito 11, extr 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MPFTLRLPIVSVSVAAPLSIAPRPYPSPPRPRPPALPPPLHAPRRIRGRRVAPRRIRGRRVDPRRIRWRVLEVGERCRGAVIGCRRAVIGCRRTLPERRRGAVIGLPSSCDPRAWNPPHPPRRYGLHHPPRRCGLHHPPRARHPGAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.08
4 0.07
5 0.1
6 0.11
7 0.11
8 0.1
9 0.15
10 0.18
11 0.24
12 0.34
13 0.4
14 0.49
15 0.57
16 0.65
17 0.69
18 0.72
19 0.72
20 0.71
21 0.74
22 0.7
23 0.66
24 0.59
25 0.6
26 0.63
27 0.6
28 0.57
29 0.5
30 0.5
31 0.57
32 0.6
33 0.56
34 0.56
35 0.63
36 0.68
37 0.73
38 0.76
39 0.74
40 0.78
41 0.83
42 0.84
43 0.81
44 0.78
45 0.78
46 0.78
47 0.79
48 0.8
49 0.78
50 0.8
51 0.83
52 0.8
53 0.72
54 0.64
55 0.6
56 0.54
57 0.48
58 0.46
59 0.38
60 0.38
61 0.38
62 0.35
63 0.3
64 0.25
65 0.22
66 0.14
67 0.18
68 0.19
69 0.22
70 0.23
71 0.23
72 0.23
73 0.23
74 0.27
75 0.29
76 0.28
77 0.25
78 0.27
79 0.3
80 0.35
81 0.44
82 0.46
83 0.47
84 0.5
85 0.49
86 0.49
87 0.46
88 0.44
89 0.38
90 0.35
91 0.29
92 0.22
93 0.22
94 0.2
95 0.22
96 0.19
97 0.17
98 0.16
99 0.17
100 0.28
101 0.31
102 0.39
103 0.47
104 0.57
105 0.67
106 0.69
107 0.67
108 0.61
109 0.64
110 0.63
111 0.63
112 0.63
113 0.65
114 0.7
115 0.72
116 0.75
117 0.75
118 0.72
119 0.65
120 0.63
121 0.63
122 0.65
123 0.7
124 0.72
125 0.72
126 0.77
127 0.83