Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CUX9

Protein Details
Accession A0A550CUX9   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
156-180TETAAPKPRPKPKPLPRTKPQPAAPHydrophilic
NLS Segment(s)
PositionSequence
161-236PKPRPKPKPLPRTKPQPAAPPSPKGKNKRESPPPAVDEAPPPAVRPIKRSRPSPPPQQRKSAPLKKFAPPRKETPP
Subcellular Location(s) nucl 16, cyto_nucl 12.833, cyto 7.5, cyto_mito 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR019194  Tscrpt_elong_fac_Eaf_N  
Pfam View protein in Pfam  
PF09816  EAF  
Amino Acid Sequences MAQETPWLPAHGKHSVSIGSSLSKALQARKNQSGPPNPSKFDKHFYGVRYNHKPSSIDTSRLGSIERNPENKEFPVTLQQPSKDNKQLEWQEWTCTQSYVLEKVESSINMTFVRRRLSNEPVIPPLQPSGTDDLASELEDALRAQESSEEGEIPLTETAAPKPRPKPKPLPRTKPQPAAPPSPKGKNKRESPPPAVDEAPPPAVRPIKRSRPSPPPQQRKSAPLKKFAPPRKETPPPKEELMFPTAGGGITLPGASGFAQPAPAPSPPPARAPTPPPRAPSPPPAAEPVASDSEEEDWDEVPAAPTPAFDGLELEEIDGDDLLERELTSQLGGGGDESMAAGEPDDEGDDDMFDVFEQEMNMQLGEGNAEVEQEDEDDFLAGAMDPPPPSDVGAPMSLNKLAGGGDDYDDYSSSSEEDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.31
4 0.29
5 0.25
6 0.2
7 0.2
8 0.2
9 0.18
10 0.2
11 0.21
12 0.27
13 0.33
14 0.39
15 0.47
16 0.55
17 0.59
18 0.62
19 0.68
20 0.69
21 0.72
22 0.73
23 0.73
24 0.67
25 0.67
26 0.69
27 0.65
28 0.62
29 0.57
30 0.52
31 0.5
32 0.52
33 0.56
34 0.55
35 0.6
36 0.62
37 0.63
38 0.62
39 0.6
40 0.57
41 0.5
42 0.53
43 0.48
44 0.42
45 0.38
46 0.38
47 0.36
48 0.35
49 0.33
50 0.26
51 0.27
52 0.33
53 0.37
54 0.38
55 0.4
56 0.43
57 0.46
58 0.45
59 0.43
60 0.35
61 0.31
62 0.36
63 0.35
64 0.37
65 0.38
66 0.39
67 0.41
68 0.44
69 0.49
70 0.47
71 0.46
72 0.42
73 0.47
74 0.51
75 0.48
76 0.52
77 0.46
78 0.42
79 0.42
80 0.43
81 0.34
82 0.28
83 0.25
84 0.2
85 0.22
86 0.21
87 0.21
88 0.2
89 0.18
90 0.19
91 0.21
92 0.17
93 0.18
94 0.14
95 0.15
96 0.15
97 0.17
98 0.19
99 0.2
100 0.24
101 0.23
102 0.27
103 0.3
104 0.36
105 0.42
106 0.44
107 0.44
108 0.44
109 0.43
110 0.38
111 0.34
112 0.29
113 0.21
114 0.17
115 0.16
116 0.16
117 0.15
118 0.15
119 0.14
120 0.14
121 0.14
122 0.14
123 0.12
124 0.07
125 0.07
126 0.07
127 0.06
128 0.05
129 0.05
130 0.05
131 0.05
132 0.06
133 0.06
134 0.08
135 0.09
136 0.08
137 0.08
138 0.08
139 0.08
140 0.08
141 0.07
142 0.06
143 0.06
144 0.07
145 0.09
146 0.16
147 0.19
148 0.24
149 0.33
150 0.42
151 0.49
152 0.56
153 0.65
154 0.68
155 0.76
156 0.81
157 0.83
158 0.81
159 0.85
160 0.85
161 0.82
162 0.75
163 0.74
164 0.68
165 0.68
166 0.64
167 0.6
168 0.57
169 0.58
170 0.61
171 0.61
172 0.64
173 0.63
174 0.67
175 0.69
176 0.74
177 0.73
178 0.72
179 0.7
180 0.63
181 0.57
182 0.51
183 0.43
184 0.34
185 0.28
186 0.24
187 0.17
188 0.15
189 0.15
190 0.18
191 0.18
192 0.23
193 0.29
194 0.37
195 0.42
196 0.46
197 0.5
198 0.56
199 0.62
200 0.67
201 0.7
202 0.7
203 0.69
204 0.73
205 0.69
206 0.67
207 0.71
208 0.69
209 0.62
210 0.6
211 0.61
212 0.59
213 0.66
214 0.66
215 0.64
216 0.59
217 0.61
218 0.6
219 0.66
220 0.67
221 0.66
222 0.63
223 0.57
224 0.55
225 0.51
226 0.45
227 0.38
228 0.34
229 0.26
230 0.2
231 0.17
232 0.15
233 0.13
234 0.11
235 0.07
236 0.04
237 0.04
238 0.04
239 0.03
240 0.03
241 0.03
242 0.04
243 0.05
244 0.05
245 0.05
246 0.06
247 0.06
248 0.07
249 0.09
250 0.09
251 0.1
252 0.13
253 0.18
254 0.19
255 0.24
256 0.25
257 0.26
258 0.29
259 0.35
260 0.43
261 0.46
262 0.49
263 0.48
264 0.5
265 0.54
266 0.55
267 0.55
268 0.52
269 0.45
270 0.43
271 0.43
272 0.4
273 0.34
274 0.31
275 0.26
276 0.21
277 0.18
278 0.16
279 0.13
280 0.14
281 0.13
282 0.12
283 0.1
284 0.08
285 0.08
286 0.08
287 0.08
288 0.07
289 0.08
290 0.09
291 0.08
292 0.07
293 0.09
294 0.09
295 0.09
296 0.08
297 0.08
298 0.08
299 0.11
300 0.11
301 0.09
302 0.08
303 0.08
304 0.08
305 0.07
306 0.06
307 0.04
308 0.04
309 0.04
310 0.04
311 0.04
312 0.05
313 0.06
314 0.06
315 0.06
316 0.06
317 0.07
318 0.07
319 0.07
320 0.06
321 0.06
322 0.05
323 0.05
324 0.05
325 0.04
326 0.04
327 0.04
328 0.04
329 0.03
330 0.04
331 0.04
332 0.05
333 0.05
334 0.06
335 0.06
336 0.06
337 0.06
338 0.06
339 0.06
340 0.05
341 0.06
342 0.05
343 0.06
344 0.06
345 0.06
346 0.09
347 0.09
348 0.09
349 0.08
350 0.08
351 0.08
352 0.08
353 0.08
354 0.06
355 0.05
356 0.06
357 0.06
358 0.06
359 0.06
360 0.06
361 0.07
362 0.06
363 0.06
364 0.06
365 0.06
366 0.06
367 0.06
368 0.05
369 0.06
370 0.07
371 0.09
372 0.09
373 0.1
374 0.11
375 0.12
376 0.13
377 0.13
378 0.14
379 0.15
380 0.18
381 0.18
382 0.19
383 0.21
384 0.21
385 0.19
386 0.17
387 0.14
388 0.12
389 0.11
390 0.12
391 0.1
392 0.11
393 0.12
394 0.13
395 0.13
396 0.13
397 0.13
398 0.12
399 0.11
400 0.1