Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CLV5

Protein Details
Accession A0A550CLV5    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-58MAPPASAPAKKKKKDKKRKREATPDEPPHHRBasic
NLS Segment(s)
PositionSequence
15-87KGKGKGKAPAPPAMAPPASAPAKKKKKDKKRKREATPDEPPHHRPRSVTPSAVATKSGPPPSSSKAKKKSKPS
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MAKADDIDAIFASSKGKGKGKAPAPPAMAPPASAPAKKKKKDKKRKREATPDEPPHHRPRSVTPSAVATKSGPPPSSSKAKKKSKPSVEEEKFKDSKGSSSRRQTEEGWSVYKVDELGIDETAGDTPLCPFDCECCHLRLDLFR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.24
4 0.27
5 0.31
6 0.39
7 0.44
8 0.49
9 0.5
10 0.51
11 0.51
12 0.49
13 0.47
14 0.43
15 0.37
16 0.29
17 0.26
18 0.25
19 0.24
20 0.24
21 0.26
22 0.33
23 0.43
24 0.5
25 0.59
26 0.64
27 0.73
28 0.82
29 0.89
30 0.9
31 0.91
32 0.94
33 0.94
34 0.95
35 0.93
36 0.91
37 0.9
38 0.88
39 0.82
40 0.76
41 0.71
42 0.69
43 0.63
44 0.54
45 0.45
46 0.44
47 0.47
48 0.45
49 0.4
50 0.33
51 0.34
52 0.35
53 0.33
54 0.26
55 0.18
56 0.18
57 0.21
58 0.22
59 0.18
60 0.17
61 0.2
62 0.23
63 0.31
64 0.35
65 0.4
66 0.48
67 0.58
68 0.63
69 0.71
70 0.77
71 0.78
72 0.79
73 0.77
74 0.78
75 0.74
76 0.75
77 0.69
78 0.66
79 0.58
80 0.5
81 0.46
82 0.35
83 0.36
84 0.36
85 0.4
86 0.4
87 0.49
88 0.56
89 0.56
90 0.58
91 0.53
92 0.53
93 0.52
94 0.47
95 0.39
96 0.33
97 0.3
98 0.27
99 0.26
100 0.18
101 0.12
102 0.1
103 0.1
104 0.11
105 0.1
106 0.1
107 0.09
108 0.1
109 0.1
110 0.09
111 0.07
112 0.05
113 0.06
114 0.1
115 0.11
116 0.12
117 0.12
118 0.16
119 0.2
120 0.24
121 0.26
122 0.25
123 0.25
124 0.25