Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CEB2

Protein Details
Accession A0A550CEB2   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-91RADILRRNSARRRTRRKTRTPAGRLSSSHydrophilic
NLS Segment(s)
PositionSequence
69-84RRNSARRRTRRKTRTP
Subcellular Location(s) nucl 9mito 9mito_nucl 9
Family & Domain DBs
Amino Acid Sequences MSVFHAHQLLLLNLPRAQTQRNCPDCPSRHADPRDSFNGCLLLVPSHTQFSKLYESFLTPPLLRADILRRNSARRRTRRKTRTPAGRLSSSLIDRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.25
5 0.27
6 0.34
7 0.43
8 0.48
9 0.49
10 0.5
11 0.58
12 0.56
13 0.56
14 0.54
15 0.49
16 0.51
17 0.53
18 0.57
19 0.51
20 0.52
21 0.52
22 0.47
23 0.42
24 0.34
25 0.31
26 0.23
27 0.2
28 0.15
29 0.1
30 0.08
31 0.09
32 0.08
33 0.09
34 0.09
35 0.1
36 0.1
37 0.12
38 0.17
39 0.16
40 0.17
41 0.16
42 0.18
43 0.18
44 0.2
45 0.19
46 0.14
47 0.15
48 0.15
49 0.16
50 0.14
51 0.14
52 0.19
53 0.24
54 0.27
55 0.32
56 0.33
57 0.4
58 0.48
59 0.56
60 0.6
61 0.64
62 0.72
63 0.76
64 0.85
65 0.89
66 0.92
67 0.92
68 0.92
69 0.93
70 0.9
71 0.89
72 0.85
73 0.78
74 0.69
75 0.63
76 0.58