Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A550CH17

Protein Details
Accession A0A550CH17   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
125-145ISSGPPPKKSGRKRERAATASHydrophilic
NLS Segment(s)
PositionSequence
130-140PPKKSGRKRER
Subcellular Location(s) nucl 14, cyto_nucl 12.5, cyto 9, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015418  Eaf6  
Gene Ontology GO:0035267  C:NuA4 histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0016740  F:transferase activity  
GO:0006325  P:chromatin organization  
GO:0006281  P:DNA repair  
GO:0016573  P:histone acetylation  
Pfam View protein in Pfam  
PF09340  NuA4  
Amino Acid Sequences MAEPSPQDKERYEALKKQIAQSIANKRNMDAQLARIETKIHALEGSYLGDSHMGGNIVQGFDGYLKATPGGAGGGTGRARRHDVTDADRIFSASSMTWQKSLELIEDEGGTPAPETNNTIKLPSISSGPPPKKSGRKRERAATASDFDDEEIHLPAQTSSGRKTKKTRTMDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.53
3 0.54
4 0.55
5 0.54
6 0.49
7 0.46
8 0.48
9 0.52
10 0.52
11 0.57
12 0.53
13 0.48
14 0.53
15 0.5
16 0.46
17 0.37
18 0.32
19 0.31
20 0.33
21 0.33
22 0.26
23 0.26
24 0.21
25 0.23
26 0.2
27 0.14
28 0.12
29 0.11
30 0.13
31 0.13
32 0.13
33 0.09
34 0.09
35 0.08
36 0.09
37 0.08
38 0.07
39 0.07
40 0.06
41 0.05
42 0.06
43 0.07
44 0.07
45 0.06
46 0.06
47 0.05
48 0.05
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.06
62 0.07
63 0.09
64 0.09
65 0.11
66 0.13
67 0.14
68 0.16
69 0.18
70 0.2
71 0.22
72 0.29
73 0.28
74 0.26
75 0.26
76 0.23
77 0.19
78 0.17
79 0.13
80 0.05
81 0.08
82 0.11
83 0.12
84 0.12
85 0.13
86 0.13
87 0.13
88 0.14
89 0.12
90 0.1
91 0.1
92 0.09
93 0.09
94 0.09
95 0.08
96 0.08
97 0.07
98 0.05
99 0.06
100 0.05
101 0.06
102 0.09
103 0.11
104 0.16
105 0.16
106 0.17
107 0.17
108 0.17
109 0.18
110 0.15
111 0.16
112 0.13
113 0.19
114 0.28
115 0.32
116 0.36
117 0.39
118 0.46
119 0.53
120 0.62
121 0.67
122 0.68
123 0.74
124 0.77
125 0.82
126 0.84
127 0.77
128 0.74
129 0.68
130 0.6
131 0.51
132 0.45
133 0.36
134 0.27
135 0.24
136 0.18
137 0.13
138 0.12
139 0.11
140 0.1
141 0.1
142 0.1
143 0.11
144 0.14
145 0.16
146 0.2
147 0.29
148 0.34
149 0.4
150 0.5
151 0.58
152 0.65