Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550BT03

Protein Details
Accession A0A550BT03    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
108-140GPPQGIRPPRDNPRRRRARDHRYRSRTRGIRICBasic
NLS Segment(s)
PositionSequence
113-135IRPPRDNPRRRRARDHRYRSRTR
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MRTPSSSPHSETPLSAHVKPSPSAYIEPPSISNLYPLQAAATRAPPASIVIILRPHPPRALPSTIPLYLHLHPRRCLPAPSTRQSTPAICPATHLPPPPFIHLPQAPGPPQGIRPPRDNPRRRRARDHRYRSRTRGIRICTGGIDCDMPRDIYDDVPRGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.35
3 0.34
4 0.33
5 0.34
6 0.35
7 0.34
8 0.29
9 0.27
10 0.28
11 0.28
12 0.29
13 0.27
14 0.27
15 0.25
16 0.25
17 0.23
18 0.21
19 0.2
20 0.16
21 0.15
22 0.14
23 0.13
24 0.12
25 0.12
26 0.14
27 0.13
28 0.14
29 0.15
30 0.14
31 0.14
32 0.13
33 0.12
34 0.11
35 0.1
36 0.09
37 0.09
38 0.11
39 0.13
40 0.18
41 0.19
42 0.2
43 0.2
44 0.2
45 0.22
46 0.25
47 0.28
48 0.23
49 0.25
50 0.28
51 0.28
52 0.27
53 0.26
54 0.24
55 0.21
56 0.3
57 0.31
58 0.3
59 0.3
60 0.33
61 0.35
62 0.33
63 0.33
64 0.27
65 0.32
66 0.35
67 0.39
68 0.42
69 0.38
70 0.39
71 0.39
72 0.37
73 0.3
74 0.3
75 0.27
76 0.21
77 0.22
78 0.22
79 0.24
80 0.25
81 0.26
82 0.2
83 0.24
84 0.26
85 0.29
86 0.28
87 0.25
88 0.29
89 0.27
90 0.3
91 0.28
92 0.3
93 0.26
94 0.25
95 0.26
96 0.21
97 0.22
98 0.26
99 0.29
100 0.29
101 0.33
102 0.39
103 0.49
104 0.59
105 0.66
106 0.68
107 0.72
108 0.8
109 0.82
110 0.86
111 0.86
112 0.87
113 0.89
114 0.9
115 0.9
116 0.89
117 0.92
118 0.88
119 0.88
120 0.84
121 0.81
122 0.79
123 0.73
124 0.72
125 0.65
126 0.59
127 0.51
128 0.45
129 0.37
130 0.3
131 0.27
132 0.18
133 0.18
134 0.18
135 0.16
136 0.15
137 0.17
138 0.17
139 0.18
140 0.24