Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550BWF6

Protein Details
Accession A0A550BWF6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
228-261PLDTCRPRPMRSLRPRPMRSLRPRPMRSPRLVLCHydrophilic
NLS Segment(s)
PositionSequence
238-252RSLRPRPMRSLRPRP
Subcellular Location(s) cyto 18, mito 7
Family & Domain DBs
Amino Acid Sequences MIEDAQAVLRGARLVCGDEGATRGLAFRAGDAGKHGEEGHGVREVVLGKGVGGEARKEGAAALGACLEELGASGGYGGHVDLFAVRSVVAEGRGAAESEAVVVVGHGVRVGVGVDVGALEPGRDAVFVLRGFVFAIERLKTRKGTLGLGRRLESEPVRIVLIAVRGSRLSMMMARKITARRHIGTRPACPQLHKTRTGPLLSHPHLPRHQYRTKTRCERPAYLPFPLPLDTCRPRPMRSLRPRPMRSLRPRPMRSPRLVLCGVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.14
4 0.14
5 0.12
6 0.14
7 0.13
8 0.12
9 0.1
10 0.11
11 0.1
12 0.11
13 0.1
14 0.09
15 0.13
16 0.13
17 0.13
18 0.15
19 0.18
20 0.17
21 0.18
22 0.18
23 0.13
24 0.16
25 0.16
26 0.16
27 0.15
28 0.15
29 0.13
30 0.16
31 0.16
32 0.14
33 0.13
34 0.11
35 0.08
36 0.09
37 0.09
38 0.08
39 0.08
40 0.08
41 0.08
42 0.1
43 0.09
44 0.09
45 0.09
46 0.08
47 0.09
48 0.08
49 0.08
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.04
56 0.04
57 0.04
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.04
69 0.05
70 0.05
71 0.05
72 0.05
73 0.05
74 0.06
75 0.06
76 0.06
77 0.05
78 0.06
79 0.07
80 0.07
81 0.07
82 0.06
83 0.06
84 0.05
85 0.05
86 0.05
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.02
101 0.02
102 0.03
103 0.03
104 0.03
105 0.02
106 0.02
107 0.02
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.06
114 0.06
115 0.07
116 0.07
117 0.07
118 0.07
119 0.07
120 0.07
121 0.05
122 0.07
123 0.07
124 0.09
125 0.11
126 0.13
127 0.14
128 0.15
129 0.19
130 0.19
131 0.22
132 0.28
133 0.35
134 0.38
135 0.39
136 0.39
137 0.37
138 0.36
139 0.34
140 0.27
141 0.21
142 0.17
143 0.16
144 0.15
145 0.13
146 0.12
147 0.1
148 0.12
149 0.1
150 0.09
151 0.09
152 0.09
153 0.09
154 0.09
155 0.08
156 0.07
157 0.09
158 0.11
159 0.15
160 0.15
161 0.16
162 0.19
163 0.24
164 0.27
165 0.31
166 0.35
167 0.33
168 0.38
169 0.42
170 0.48
171 0.48
172 0.5
173 0.48
174 0.49
175 0.48
176 0.45
177 0.5
178 0.51
179 0.52
180 0.52
181 0.48
182 0.48
183 0.52
184 0.51
185 0.44
186 0.4
187 0.43
188 0.4
189 0.47
190 0.43
191 0.45
192 0.47
193 0.52
194 0.53
195 0.52
196 0.57
197 0.57
198 0.66
199 0.67
200 0.73
201 0.77
202 0.78
203 0.79
204 0.79
205 0.77
206 0.74
207 0.76
208 0.7
209 0.64
210 0.59
211 0.5
212 0.45
213 0.41
214 0.34
215 0.26
216 0.3
217 0.3
218 0.32
219 0.39
220 0.41
221 0.42
222 0.5
223 0.57
224 0.6
225 0.66
226 0.73
227 0.75
228 0.82
229 0.84
230 0.84
231 0.85
232 0.84
233 0.84
234 0.84
235 0.84
236 0.84
237 0.86
238 0.86
239 0.87
240 0.86
241 0.82
242 0.81
243 0.75
244 0.72