Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A550BYN2

Protein Details
Accession A0A550BYN2    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
182-211VAGEGGSRRRRGRKHRRRGGRERRRRRIERBasic
NLS Segment(s)
PositionSequence
186-211GGSRRRRGRKHRRRGGRERRRRRIER
Subcellular Location(s) mito 12, cyto 9, cyto_nucl 8.5, nucl 6
Family & Domain DBs
Amino Acid Sequences MMAGRLASPAERVVSTAERVVPGTGDSPPGRVSVDGGEGRVVAEECCVSREHRRPGRRVVAAGGEDRIAGEGRVAGEGGWRHRRRGSLSTATRIASLGRGESPPEGSIASPPEGRIASTPGRIVSTAEGSESSPAESIASPPEGRIASTATRIASTAGNRMLMLGSIAIDGGEDRIAGEGRVAGEGGSRRRRGRKHRRRGGRERRRRRIER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.2
4 0.2
5 0.19
6 0.2
7 0.19
8 0.16
9 0.14
10 0.14
11 0.12
12 0.16
13 0.15
14 0.16
15 0.17
16 0.17
17 0.17
18 0.15
19 0.16
20 0.12
21 0.18
22 0.17
23 0.16
24 0.16
25 0.15
26 0.14
27 0.14
28 0.13
29 0.07
30 0.07
31 0.08
32 0.07
33 0.09
34 0.1
35 0.12
36 0.21
37 0.29
38 0.39
39 0.47
40 0.55
41 0.59
42 0.67
43 0.74
44 0.68
45 0.61
46 0.53
47 0.48
48 0.42
49 0.38
50 0.29
51 0.2
52 0.16
53 0.15
54 0.13
55 0.08
56 0.06
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.05
63 0.07
64 0.09
65 0.14
66 0.24
67 0.24
68 0.27
69 0.29
70 0.32
71 0.35
72 0.38
73 0.4
74 0.4
75 0.42
76 0.44
77 0.44
78 0.41
79 0.36
80 0.31
81 0.24
82 0.16
83 0.13
84 0.09
85 0.09
86 0.08
87 0.09
88 0.09
89 0.1
90 0.08
91 0.09
92 0.08
93 0.07
94 0.08
95 0.09
96 0.1
97 0.09
98 0.09
99 0.1
100 0.1
101 0.1
102 0.09
103 0.12
104 0.12
105 0.13
106 0.14
107 0.12
108 0.13
109 0.13
110 0.13
111 0.1
112 0.1
113 0.09
114 0.09
115 0.09
116 0.08
117 0.09
118 0.09
119 0.08
120 0.06
121 0.06
122 0.07
123 0.06
124 0.07
125 0.08
126 0.1
127 0.09
128 0.09
129 0.12
130 0.11
131 0.11
132 0.12
133 0.12
134 0.12
135 0.14
136 0.16
137 0.13
138 0.13
139 0.13
140 0.14
141 0.14
142 0.14
143 0.16
144 0.16
145 0.16
146 0.15
147 0.16
148 0.14
149 0.11
150 0.1
151 0.06
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.04
161 0.04
162 0.05
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.06
170 0.05
171 0.08
172 0.13
173 0.21
174 0.29
175 0.35
176 0.42
177 0.51
178 0.61
179 0.69
180 0.76
181 0.79
182 0.83
183 0.88
184 0.92
185 0.94
186 0.96
187 0.96
188 0.96
189 0.96
190 0.96
191 0.96